Home > Product > Antimicrobial Peptides > Pyrularia thionin

Antimicrobial Peptides

Pyrularia thionin

Price Inquiry
CAT#
AF3221
Sequence
KSCCRNTWARNCYNVCRLPGTISREICAKKCDCKIISGTTCPSDYPK
Host Chemicals
nuts, Pyrularia pubera
Length
47
Activity
Gram+ & Gram-, Mammalian cells, Cancer cells
SwissProt ID
SwissProt ID: P07504

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.