Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | FTMKKSLLPLFFLGTITLSLCEQERGADEEEGNGEKE |
Activity | Antimicrobial |
Host Chemicals | Rana catesbeiana |
Length | 37 |
SwissProt ID | C5IAZ5 |
1. High fat diet and GLP-1 drugs induce pancreatic injury in mice
3. Store-operated Ca2+ entry sustains the fertilization Ca2+ signal in pig eggs
4. The spatiotemporal control of signalling and trafficking of the GLP-1R
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.