Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | DHYNCVRSGGQCLYSACPIYTRIQGTCYHGKAKCCK |
Activity | Antibacterial |
Host Chemicals | Macaca mulatta |
Length | 36 |
SwissProt ID | O18794 |
3. TMEM16F and dynamins control expansive plasma membrane reservoirs
4. Autoinhibition and phosphorylation-induced activation of phospholipase C-γ isozymes
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.