CAT# | AF2486 |
Sequence | DHYNCVRSGGQCLYSACPIYTRIQGTCYHGKAKCCK |
Activity | Antibacterial |
Host Chemicals | Macaca mulatta | Length | 36 | SwissProt ID | O18794 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF2064 | Palustrin-2LTa | Inquiry | ||
AF2791 | Casocidin-1 | Inquiry | ||
AF2406 | Cupiennin-1 | Inquiry | ||
AF3325 | PgAFP | Inquiry | ||
AF530 | Aurein-3.3 | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×2. Store-operated Ca2+ entry sustains the fertilization Ca2+ signal in pig eggs
3. Autoinhibition and phosphorylation-induced activation of phospholipase C-γ isozymes
4. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
5. An Open-label, Single-center, Safety and Efficacy Study of Eyelash Polygrowth Factor Serum
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
This article will give a brief introduction about atosiban and focus on its role played in the treatment of pret ...
Ramoplanin is a new kind of glycopeptide antibiotics, which can inhibit the biosynthesis of the cell walls of gr ...
Abarelix, sold under the brand name Plenaxis, is a synthetic decapeptide and Gonadotropin-releasing hormone (GnR ...
PR 39, a porcine 39-aa peptide antibiotic, was originally isolated from the upper part of the small intestine o ...
The sodium channel subtypes NaV1.2 and NaV1.6 are the two major forms of excitatory pyramidal neurons in the cer ...