Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | VTCDLLSFKGQVNDSACAANCLSLGKAGGHCEKVGCICRKTSFKDLWDKRF |
Activity | Gram+, |
Host Chemicals | royal jelly honeybee, Apis mellifera L. |
Length | 51 |
SwissProt ID | SwissProt ID: P17722 |
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.