Keywords Search Google Search Search

Secretoneurin

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	C45002
Sequence	TNEIVEEQYTPQSLATLESVFQELGKLTGPNNQ

CAT#	Product Name	Inquiry
X01930	PH1VV017_01	Inquiry
X14137	PM_8057835	Inquiry
X07928	PM_16403526	Inquiry
X02893	PM_10569954	Inquiry
C5110	Decanoyl-Arg-Arg-Leu-Leu-chloromethylketone	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

The opiate delta receptor antagonist-ICI 154,129

ICl 154,129 is a new compound that shows selectivity as an antagonist of [Leu5]enkephalin and [D-AIa2, D-Leu5]en ...

Brief information of insulin

Insulin was discovered by Banting and Best in 1921. Soon afterwards manufacturing processes were developed to extract the ins ...

Function of perindopril erbumine in hypertension

Perindopril erbumine is an angiotensioncon vertingenzyme (ACE) inhibitor without sulfhydryl group. It is a chi ...

Function of D15 As An Endocytosis Inhibitor

The endocytosis of AMPA receptors (AMPARs) requires the GTPase activity of dynamin. Since it is now established ...

What is PT-141?

PT-141, also called as Bremelanotide, is a derivative for Melanotan 2 (M2). Unlike M2, PT-141 lacks C-terminal a ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: