Secretoneurin, rat

Secretoneurin, rat, a 33-amino acid polypeptide, is generated by proteolytic processing of secretogranin II (SgII). Secretoneurin, rat induces dopamine release in the rat striatum in vivo and in vitro, and it exerts a very strong chemotactic effect on monocytes and eosinophils but not on granulocytes.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R1673

CAS No:149146-12-3

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C₁₅₉H₂₅₂N₄₀O₅₈
M.W/Mr.
3651.95
Sequence
One Letter Code: TNEIVEEQYTPQSLATLESVFQELGKLTGPSNQ
three Letter Code: Thr-Asn-Glu-Ile-Val-Glu-Glu-Gln-Tyr-Thr-Pro-Gln-Ser-Leu-Ala-Thr-Leu-Glu-Ser-Val-Phe-Gln-Glu-Leu-Gly-Lys-Leu-Thr-Gly-Pro-Ser-Asn-Gln

Secretoneurin, rat, is a biologically active neuropeptide derived from the precursor protein secretogranin II, predominantly expressed in neuroendocrine tissues. As a member of the chromogranin/secretogranin family, secretoneurin is characterized by its conserved sequence and multifunctional regulatory roles within the nervous and endocrine systems. In rat models, this peptide has been extensively studied for its involvement in neuronal signaling, neuroinflammation, and modulation of cellular migration, making it a valuable tool for elucidating the molecular mechanisms underlying neuropeptide function. Its unique biochemical properties and specific receptor interactions have positioned it as a key reagent in both basic neuroscience and translational research, particularly where peptide-mediated cellular responses are of interest.

Neuroscience research: Secretoneurin is widely utilized in studies investigating neuropeptide signaling pathways and neurotransmitter release in the central and peripheral nervous systems. Its ability to modulate dopaminergic and glutamatergic transmission provides a robust model for examining synaptic plasticity, neuronal communication, and the regulation of neuroendocrine secretory processes. Researchers often employ this peptide to dissect the molecular events associated with synaptic vesicle trafficking and to map the downstream effects of neuropeptide receptor activation in rat neural tissues.

Cell migration and angiogenesis studies: The peptide is a potent chemoattractant for various cell types, including endothelial cells and immune cells. In vitro and ex vivo assays frequently leverage secretoneurin to characterize mechanisms of chemotaxis, angiogenesis, and tissue remodeling. Its capacity to stimulate endothelial cell migration and promote neovascularization makes it particularly valuable for exploring the cellular and molecular basis of vascular development and repair, as well as for modeling inflammatory responses in rat-derived systems.

Signal transduction analysis: Secretoneurin is instrumental in delineating intracellular signaling cascades triggered by neuropeptide-receptor interactions. Studies often focus on its activation of mitogen-activated protein kinase (MAPK), phospholipase C, and other second messenger pathways. By applying this peptide to cultured cells or tissue explants, investigators can probe the specificity and dynamics of downstream signaling events, enabling a deeper understanding of how neuropeptides influence gene expression, cell survival, and functional adaptation in rat models.

Neuroinflammation modeling: Owing to its regulatory effects on immune cell migration and cytokine release, secretoneurin is frequently employed in experimental models of neuroinflammation. It serves as a tool for dissecting the interplay between neuronal and glial cells during inflammatory processes, as well as for identifying potential modulators of neuroimmune interactions. Applications in this area include studying microglial activation, leukocyte infiltration, and the molecular mediators of neuroinflammatory signaling in rat brain and spinal cord tissues.

Peptide receptor characterization: Secretoneurin provides a defined ligand for the identification, binding affinity assessment, and functional analysis of neuropeptide receptors in rat tissues. By utilizing radiolabeled or fluorescently tagged forms, researchers can map receptor distribution, quantify binding kinetics, and elucidate receptor-mediated cellular responses. These studies are essential for advancing the understanding of neuropeptide-receptor specificity, signaling diversity, and the physiological roles of secretogranin-derived peptides in mammalian systems.

Source#
Synthetic

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Synthesis ServicesPeptide Analysis ServicesEpitope Mapping ServicesCustom Conjugation ServicePeptide Nucleic Acids SynthesisPeptide Modification ServicesPeptide CDMOcGMP Peptide Service
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers