Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | SDEKASPDKHHRFSLSRYAKLANRLANPKLLETFLSKWIGDRGNRSV |
Activity | Gram+ & Gram-, Fungi, Mammalian cells, |
Host Chemicals | Bovine Bos taurus |
Length | 47 |
SwissProt ID | SwissProt ID: P06833 |
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.