(Ser8)-GLP-1 (7-36), amide, human

(Ser8)-GLP-1 (7-36), amide, human substitutes serine near the N-terminus, subtly altering hydrogen-bond networks within the helical core. The amidated C-terminus enhances conformational stability and mimics native processing. Researchers apply this analog to evaluate receptor-contact regions and proteolytic susceptibility. Its tailored sequence supports detailed mechanistic studies of incretin peptides.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: G16003

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C149H225N40O46
M.W/Mr.
3312.7
Sequence
SEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
Length
29

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
cGMP Peptide ServicePeptide Synthesis ServicesEpitope Mapping ServicesCustom Conjugation ServicePeptide Modification ServicesPeptide Analysis ServicesPeptide Nucleic Acids SynthesisPeptide CDMO
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers