(Ser8)-GLP-1 (7-36), amide, human
(Ser8)-GLP-1 (7-36), amide, human
Online Inquiry
| CAT# | G16003 |
| M.F/Formula | C149H225N40O46 |
| M.W/Mr. | 3312.7 |
| Sequence | SEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 |
| CAT# |
Product Name |
M.W |
Molecular Formula |
Inquiry |
| G16012 |
(Des-His1,Glu9)-Glucagon (1-29) amide (human, rat, porcine) |
|
|
Inquiry |
| G16033 |
(Asp28)-Glucagon (1-29) (human, rat, porcine) |
|
|
Inquiry |
| G16006 |
GLP-2, human |
|
|
Inquiry |
| G16024 |
GLP-1 (9-36) amide (human, bovine, guinea pig, mouse, porcine, rat) |
|
|
Inquiry |
| G16014 |
(Des-Thr7)-Glucagon |
|
|
Inquiry |
Write a review
Ask a question
My Review for (Ser8)-GLP-1 (7-36), amide, human
Required fields are marked with *
×
Ask a Question for (Ser8)-GLP-1 (7-36), amide, human
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
