Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C149H225N40O46 |
M.W/Mr. | 3312.7 |
Sequence | SEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 |
Length | 29 |
1. Emu oil in combination with other active ingredients for treating skin imperfections
2. C-Peptide replacement therapy and sensory nerve function in type 1 diabetic neuropathy
5. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.