Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | KICERASGTWKGICIHSNDCNNQCVKWENAGSGSCHYQFPNYMCFCYFNC |
Activity | Fungi, |
Host Chemicals | seeds, common chickweed, Stellaria media L |
Length | 50 |
1. C-Peptide replacement therapy and sensory nerve function in type 1 diabetic neuropathy
2. Emerging applications of nanotechnology for diagnosis and therapy of disease: a review
3. Immune-awakening Saccharomyces-inspired nanocarrier for oral target delivery to lymph and tumors
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.