Home > Product > Antimicrobial Peptides > Spheniscin-1

Antimicrobial Peptides

Spheniscin-1

Price Inquiry
CAT#
AF2749
Sequence
SFGLCRLRRGFCAHGRCRFPSIPIGRCSRFVQCCRRVW
Host Chemicals
Aptenodytes patagonicus
Length
38
Activity
Antibacterial, Antifungal
SwissProt ID
P83429

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.