Keywords Search Google Search Search

Tachystatin-A2

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	T17001
Sequence	YSRCQLQGFNCVVRSYGLPTIPCCRGLTCRSYFPGSTYGRCQRY

CAT#	Product Name	Inquiry
X05203	PM_12383874	Inquiry
X11312	PM_2537426	Inquiry
X11353	PM_2547901	Inquiry
X14655	PM_8377026	Inquiry
X03800	PM_11081798	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Liraglutide for type 2 diabetes and weight loss

Glucagon-like peptide-1 (GLP-1) and glucose-depended insulinotropic polypeptide (GIP) are the two peptides that have been con ...

PKC (19-36), a selective PKC peptide inhibitor

PKC (19-36), a synthetic peptide of the pseudosubstrate domain of the kinase, is a selective inhibitor of prote ...

Function of basic fibroblast growth factor in skin

Basic Fibroblast Growth Factor, Human, called basic fibroblast growth factor (bFGF/FGF-b/FGF-2), is a single cha ...

Fuction of afamelanotide in erythropoietic protoporphyria

Afamelanotide, a drug for tanning skin, is a synthetic peptide and analogue of α-melanocyte stimulating hormone. ...

The opiate delta receptor antagonist-ICI 154,129

ICl 154,129 is a new compound that shows selectivity as an antagonist of [Leu5]enkephalin and [D-AIa2, D-Leu5]en ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Length	44
Modifications	Disulfide bond(3)