Beclin-1 peptide is the HIV-1 Nef binding portion of full-length human Beclin-1 protein (amino acids 267-299). Beclin-1 protein is an autophagy inducing agent that may trigger cellular adaptation, survival or cell death. When conjugated to the cell-permeable peptide, it can successfully enter cells and induce autophagy. RELATED PRODUCTS:Beclin-1, Cat# 65466Tat-Beclin-1, scrambled, Cat# 65468
Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | One Letter Code: YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT Three-Letter Code: Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Gly-Thr-Asn-Val-Phe-Asn-Ala-Thr-Phe-Glu-Ile-Trp-His-Asp-Gly-Glu-Phe-Gly-Thr-OH |
Purity | % Peak Area By HPLC ≥ 95% |
Size | 1 mg |
References | Shoji-Kawata, S. Nature 494, 201-209 (2013); Marquez, RT. Am J Cancer Res 2 (2), 214–221 (2012). |
1. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
2. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
3. Low bone turnover and low BMD in Down syndrome: effect of intermittent PTH treatment
4. SERS spectrum of the peptide thymosin‐β4 obtained with Ag nanorod substrate
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.