TAT-NEP1-40

TAT-NEP1-40 fuses a TAT transduction domain with the NEP1-40 functional peptide to enhance intracellular delivery. The construct supports studies of axonal growth and intracellular signaling. Researchers assess uptake, folding, and interaction with neural targets. Applications include neuronal-delivery design, CPP engineering, and peptide-based pathway analysis.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R2830

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C268H438N88O77
M.W/Mr.
6124.89
Sequence
One Letter Code:YGRKKRRQRRRRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNS-NH2
Three Letter Code:Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Arg-Ile-Tyr-Lys-Gly-Val-Ile-Gln-Ala-Ile-Gln-Lys-Ser-Asp-Glu-Gly-His-Pro-Phe-Arg-Ala-Tyr-Leu-Glu-Ser-Glu-Val-Ala-Ile-Ser-Glu-Glu-Leu-Val-Gln-Lys-Tyr-Ser-Asn-Ser-NH2

TAT-NEP1-40 is a synthetic peptide comprising the HIV-1 TAT protein transduction domain fused to the NEP1-40 peptide, a Nogo-66 receptor antagonist fragment. As a chimeric peptide, it is engineered to facilitate efficient cellular uptake while modulating Nogo receptor signaling pathways. The TAT sequence enables the peptide to penetrate cell membranes, making it a valuable tool for delivering bioactive cargo into a wide range of cell types. Its NEP1-40 component is recognized for antagonizing the Nogo-66 receptor, a key modulator of neurite outgrowth inhibition. Together, these features position TAT-NEP1-40 as a significant reagent for investigating cellular mechanisms related to neural regeneration, axonal growth, and signal transduction in neuroscience and cell biology research.

Neurobiology research: TAT-NEP1-40 is widely utilized in studies aimed at elucidating the molecular mechanisms underlying axonal growth inhibition and neural plasticity. By antagonizing the Nogo-66 receptor pathway, it enables researchers to dissect the role of myelin-associated inhibitors in limiting neurite extension. This peptide serves as a functional probe for understanding how modulation of Nogo signaling impacts neuronal connectivity, synaptic remodeling, and the broader landscape of central nervous system development and repair.

Cellular delivery studies: The inclusion of the TAT transduction domain in this peptide makes it a robust model for investigating mechanisms of peptide-mediated intracellular delivery. Researchers employ TAT-NEP1-40 to evaluate the efficiency and kinetics of peptide uptake across various mammalian cell types, enabling optimization of delivery systems for experimental manipulation of intracellular targets. Its utility extends to studies examining endocytosis, cytosolic release, and the fate of bioactive peptides within cellular environments.

Signal transduction analysis: TAT-NEP1-40 provides a targeted approach for modulating and analyzing intracellular signaling cascades governed by the Nogo-66 receptor. By competitively inhibiting ligand-receptor interactions, it allows for controlled perturbation of downstream pathways such as RhoA/ROCK signaling, which are critical for cytoskeletal dynamics and growth cone behavior. This application is instrumental in delineating the molecular crosstalk between extracellular cues and intracellular responses in neuronal and non-neuronal cells.

Protein-protein interaction studies: The chimeric peptide is also employed as a tool for probing protein-protein interactions associated with the Nogo-66 receptor complex. Researchers use it to disrupt or mimic native ligand binding, facilitating the identification of receptor partners, co-factors, and regulatory proteins involved in the modulation of axonal growth. Such studies contribute to a deeper understanding of the structural and functional organization of receptor complexes in neural tissue.

Peptide engineering and functionalization: TAT-NEP1-40 serves as a model system for developing and testing novel peptide-based delivery platforms and receptor antagonists. Its modular design, combining a cell-penetrating sequence with a functional inhibitory domain, offers a blueprint for creating next-generation peptides with tailored bioactivity and cellular targeting properties. This application supports ongoing efforts in peptide engineering, functionalization, and the rational design of research tools for cellular and molecular neuroscience.

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Custom Conjugation ServicePeptide Nucleic Acids SynthesisPeptide Synthesis ServicesPeptide CDMOcGMP Peptide ServiceEpitope Mapping ServicesPeptide Analysis ServicesPeptide Modification Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers