TAT-NEP1-40

TAT-NEP1-40 fuses a TAT transduction domain with the NEP1-40 functional peptide to enhance intracellular delivery. The construct supports studies of axonal growth and intracellular signaling. Researchers assess uptake, folding, and interaction with neural targets. Applications include neuronal-delivery design, CPP engineering, and peptide-based pathway analysis.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R2830

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C268H438N88O77
M.W/Mr.
6124.89
Sequence
One Letter Code:YGRKKRRQRRRRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNS-NH2
Three Letter Code:Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Arg-Ile-Tyr-Lys-Gly-Val-Ile-Gln-Ala-Ile-Gln-Lys-Ser-Asp-Glu-Gly-His-Pro-Phe-Arg-Ala-Tyr-Leu-Glu-Ser-Glu-Val-Ala-Ile-Ser-Glu-Glu-Leu-Val-Gln-Lys-Tyr-Ser-Asn-Ser-NH2

TAT-NEP1-40 peptide is a specialized synthetic peptide that combines the cell-penetrating properties of the TAT sequence with the NEP1-40 domain, a well-characterized inhibitor of the Nogo-66 receptor. This unique molecular construct is widely utilized in neuroscience research due to its ability to efficiently traverse cellular membranes and modulate intracellular signaling pathways associated with neuronal growth and regeneration. The peptide's design facilitates targeted delivery into a variety of cell types, allowing researchers to investigate complex neurobiological processes with enhanced precision. Through its interaction with specific receptor sites, TAT-NEP1-40 has proven to be a valuable tool in elucidating the mechanisms underlying neuronal plasticity, axonal regeneration, and the inhibition of central nervous system repair. Its versatility and robust bioactivity make it a prominent choice for experimental applications seeking to manipulate neural pathways at the molecular level.

Neuroregeneration studies: In the context of neuroregeneration, TAT-NEP1-40 is frequently employed to probe the molecular barriers that restrict axonal growth following injury. By inhibiting the Nogo-66 receptor pathway, the peptide disrupts the inhibitory signaling that typically prevents axon extension in the adult central nervous system. Researchers can utilize this property to create experimental models that mimic the conditions of nerve repair, allowing for the investigation of strategies aimed at enhancing neural regeneration. The peptide's cell-penetrating capability ensures that it reaches intracellular targets efficiently, providing reliable and reproducible results in studies focused on overcoming the intrinsic limitations of CNS repair mechanisms.

Neuronal plasticity research: TAT-NEP1-40 peptide finds significant application in the study of neuronal plasticity, where it serves as a molecular tool to dissect the signaling cascades that regulate synaptic strength and connectivity. By modulating the activity of the Nogo-66 receptor, the peptide enables researchers to explore how inhibitory cues affect the formation and remodeling of synaptic connections. These insights are crucial for understanding the cellular basis of learning and memory, as well as for identifying potential molecular targets for interventions aimed at promoting adaptive neural changes in response to environmental stimuli or injury.

Signal transduction pathway analysis: The use of TAT-NEP1-40 extends to the detailed analysis of intracellular signal transduction pathways involved in neural inhibition. Its ability to selectively block Nogo-66 receptor-mediated signaling allows for the dissection of downstream molecular events, such as RhoA activation and cytoskeletal rearrangement. By applying the peptide in cultured neurons or tissue explants, researchers can map the functional consequences of pathway modulation, thereby uncovering novel regulatory nodes and potential intervention points within the inhibitory signaling network that governs neuronal growth and morphology.

Drug development research: TAT-NEP1-40 has gained prominence in early-stage drug discovery and development efforts targeting neurodegenerative conditions and injuries. Its mechanism of action provides a template for the identification and validation of small molecule or peptide-based therapeutics that mimic or enhance its inhibitory effects on the Nogo-66 receptor. By serving as a reference compound in high-throughput screening assays, the peptide aids in the characterization of candidate molecules, informing the design of more effective agents for modulating neuronal growth inhibition and promoting recovery in preclinical models.

Cellular delivery system validation: The TAT sequence within TAT-NEP1-40 is often leveraged to validate and optimize cellular delivery systems for bioactive peptides and proteins. Researchers utilize the peptide as a model cargo to assess the efficiency of transduction protocols across different cell types, including primary neurons and glial cells. This application is instrumental in refining techniques for intracellular delivery, ensuring that experimental manipulations achieve the desired levels of bioavailability and biological activity. The insights gained from such studies contribute to the development of advanced delivery platforms for research and therapeutic use, highlighting the peptide's utility beyond its direct neurobiological effects.

Overall, TAT-NEP1-40 peptide stands as a multifaceted tool in neuroscience and cellular biology, supporting a broad spectrum of investigative pursuits from basic mechanistic research to the development of innovative molecular delivery strategies. Its capacity to modulate inhibitory signaling, facilitate intracellular access, and serve as a benchmark for delivery systems underscores its value in advancing scientific understanding and experimental methodologies within the field.

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Synthesis ServicesEpitope Mapping ServicesPeptide CDMOcGMP Peptide ServicePeptide Modification ServicesCustom Conjugation ServicePeptide Analysis ServicesPeptide Nucleic Acids Synthesis
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers