Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.W/Mr. | 4259.7 |
Sequence | YPSKPDNPGEDAPAEDMARYYSALRHYINTITRQRY-NH2 |
Length | 36 |
2. Peptides as Active Ingredients: A Challenge for Cosmeceutical Industry
5. SERS spectrum of the peptide thymosin‐β4 obtained with Ag nanorod substrate
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.