Registration of APIs CMC information required for an IND
IND and NDA support Drug master files (DMF) filing
Sequence | IRNPVTCIRSGAICYPRSCPGSYKQIGVCGVSVIKCCKKP |
Activity | Antibacterial, Antifungal, Antiviral |
Host Chemicals | Papio anubis |
Length | 40 |
1. Implications of ligand-receptor binding kinetics on GLP-1R signalling
3. C-Peptide replacement therapy and sensory nerve function in type 1 diabetic neuropathy
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us. We will endeavor to provide highly satisfying products and services.