Registration of APIs CMC information required for an IND
IND and NDA support Drug master files (DMF) filing
Sequence | QICKAPSQTFPGLCFMDSSCRKYCIKEKFTGGHCSKLQRKCLCTKPC |
Activity | Fungi, |
Host Chemicals | tomato, Lycopersicon esculentum |
Length | 47 |
2. Emu oil in combination with other active ingredients for treating skin imperfections
5. Store-operated Ca2+ entry sustains the fertilization Ca2+ signal in pig eggs
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us. We will endeavor to provide highly satisfying products and services.