Registration of APIs CMC information required for an IND
IND and NDA support Drug master files (DMF) filing
Sequence | NPVSCVRNKGICVPIRCPGSMKQIGTCVGRAVKCCRKK |
Activity | Antibacterial, Antifungal |
Host Chemicals | Bos taurus |
Length | 38 |
SwissProt ID | P25068 |
1. Peptides as Active Ingredients: A Challenge for Cosmeceutical Industry
2. Autoinhibition and phosphorylation-induced activation of phospholipase C-γ isozymes
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us. We will endeavor to provide highly satisfying products and services.