Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP |
Length | 39 |
1. Cell-based adhesion assays for isolation of snake venom’s integrin antagonists
2. TMEM16F and dynamins control expansive plasma membrane reservoirs
3. Emu oil in combination with other active ingredients for treating skin imperfections
Required fields are marked with *
×If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.