[Tyr0] Calcitonin Gene Related Peptide, rat

[Tyr0] Calcitonin Gene Related Peptide, rat is a Tyr-extended neuropeptide variant used to probe CGRP receptor recognition and binding kinetics. The N-terminal tyrosine offers a convenient handle for spectroscopic or affinity-based labeling. Its sequence supports studies of vasodilatory signaling and sensory neuron communication. Researchers employ it to dissect structure-function relationships within the CGRP family.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: C05019

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C171H271N51O54S2
M.W/Mr.
3970.0
Sequence
YSCNTATCVTHRLAGLLSRSGGVVKDNFVPTNVGSEAF-NH2
Source#
Synthetic
Length
38

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
cGMP Peptide ServiceCustom Conjugation ServiceEpitope Mapping ServicesPeptide Nucleic Acids SynthesisPeptide CDMOPeptide Synthesis ServicesPeptide Modification ServicesPeptide Analysis Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers