Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C215H347N63O66 |
M.W/Mr. | 4870.5 |
Sequence | YDDPPLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSV-NH2 |
Length | 41 |
2. Cell-based adhesion assays for isolation of snake venom’s integrin antagonists
4. Urinary Metabolites Associated with Blood Pressure on a Low-or High-Sodium Die
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.