Ularitide

Ularitide is a synthetic form of urodilatin, a naturally occurring human natriuretic peptide that is involved in regulating blood pressure and the excretion of water and sodium from the kidneys. Urodilatin is produced in the kidney and excreted into the urine, and thus exists in low levels naturally in the systemic blood circulation. When injected into the blood, ularitide appears to cause diuresis (urine output) and natriuresis (sodium excretion), as well as vasodilation.

Online Inquiry

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	10-101-171
CAS	118812-69-4
Synonyms/Alias	Urodilatin;ularitide
M.F/Formula	C145H234N52O44S3
M.W/Mr.	3505.92646
Sequence	TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY(Disulfide bridge cys11 and cys27)
Labeling Target	Atrial natriuretic peptide receptor
Application	Ularitide is investigated for use in congestive heart failure.
Areas of Interest	Cardiovascular System & Diseases
Functions	Protein kinase activity
Disease	Congestive heart failure

CAT#	Product Name	Inquiry
10-101-322	Hexacosanedioic Acid	Inquiry
10-101-23	Lysipressin	Inquiry
10-101-167	Corticotropin	Inquiry
10-101-103	Vancomycin	Inquiry
10-101-282	Disitertide	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Source#	Synthetic
Storage	-20°C
Organism	Human
BoilingPoint	N/A
Melting Point	N/A