Ularitide

Ularitide is a synthetic form of urodilatin, a naturally occurring human natriuretic peptide that is involved in regulating blood pressure and the excretion of water and sodium from the kidneys. Urodilatin is produced in the kidney and excreted into the urine, and thus exists in low levels naturally in the systemic blood circulation. When injected into the blood, ularitide appears to cause diuresis (urine output) and natriuresis (sodium excretion), as well as vasodilation.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: 10-101-171

CAS No:118812-69-4

Synonyms/Alias:Ularitide;Urodilatin;Urodilatin human;115966-23-9;118812-69-4;Urodilatin ularitide;ularitida;Human urodilatin;Ularitide [INN];ANP 95-126;UNII-740Y5J48Z8;DTXSID50151238;740Y5J48Z8;CDD 95-126;Thr-Ala-Pro-Arg-Atrial Natriuretic Factor (1-28) (human, bovine, porcine) trifluoroacetate salt;L-Threonyl-L-alanyl-L-prolyl-L-arginyl-L-seryl-L-leucyl-L-arginyl-L-arginyl-L-seryl-L-seryl-L-cysteinyl-L-phenylalanylglycylglycyl-L-arginyl-L-methionyl-L-aspartyl-L-arginyl-L-isoleucylglycyl-L-alanyl-L-glutaminyl-L-serylglycyl-L-leucylglycyl-L-cysteinyl-L-asparaginyl-L-seryl-L-phenylalanyl-L-arginyl-L-tyrosine cyclic (11->27)-disulfide;URODILATIN [MI];Atriopeptin (95-126);Anf (95-126);Anp (95-126);Atrial natriuretic peptide (95-126);ularitidum;Urodilatin (human);ULARITIDE [WHO-DD];CHEMBL2103920;DTXCID7073729;ESP-305;URODILATIN ULARITIDE [MI];Urodilatin human, >=97% (HPLC);AKOS030213250;AT42474;DB05034;DA-58548;DA-78761;FT108857;L-Threonyl-L-alanyl-L-prolyl-L-arginyl-L-seryl-L-leucyl-L-arginyl-L-arginyl-L-seryl-L-seryl-L-cysteinyl-L-phenylalanylglycylglycyl-L-arginyl-L-methionyl-L-aspartyl-L-arginyl-L-isoleucylglycyl-L-alanyl-L-glutaminyl-L-serylglycyl-L-leucylglycyl-L-cysteinyl-L-asparaginyl-L-seryl-L-phenylalanyl-L-arginyl-L-tyrosine cyclic (11-27)-disulfide;

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C145H234N52O44S3
M.W/Mr.
3505.9
Sequence
One Letter Code:TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY
Three Letter Code:H-Thr-Ala-Pro-Arg-Ser-Leu-Arg-Arg-Ser-Ser-Cys(1)-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys(1)-Asn-Ser-Phe-Arg-Tyr-OH
Labeling Target
Atrial natriuretic peptide receptor
Application
Ularitide is investigated for use in congestive heart failure.
Areas of Interest
Cardiovascular System & Diseases
Functions
Protein kinase activity

Ularitide is a synthetic analog of the naturally occurring human natriuretic peptide urodilatin, designed to mimic and enhance the physiological actions of natriuretic peptides within biological systems. As a peptide compound, it exhibits potent natriuretic, diuretic, and vasodilatory properties, making it a valuable research tool for probing cardiovascular and renal physiology. Ularitide's molecular structure allows it to interact with natriuretic peptide receptors, triggering intracellular cascades that influence fluid and electrolyte balance, vascular tone, and cellular signaling. Its stability and specificity offer significant advantages for experimental reproducibility and mechanistic studies, supporting its widespread adoption in laboratory investigations focused on cardiovascular and renal health.

Cardiovascular Research: Ularitide serves as a critical agent in studies exploring the regulation of blood pressure and vascular homeostasis. By activating natriuretic peptide receptor-A (NPR-A), it stimulates cyclic guanosine monophosphate (cGMP) production, leading to smooth muscle relaxation and vasodilation. Researchers utilize it to model the effects of endogenous natriuretic peptides on vascular tone, endothelial function, and hemodynamics, providing insights into the pathophysiology of hypertension, heart failure, and other cardiovascular disorders. Its application in ex vivo and in vivo models enables the dissection of signaling pathways involved in cardiovascular regulation and the identification of potential therapeutic targets.

Renal Physiology Studies: Ularitide is extensively employed in experimental systems to investigate renal sodium and water handling. Its natriuretic and diuretic actions, mediated via the kidney's collecting ducts, facilitate studies on fluid homeostasis, glomerular filtration, and tubular reabsorption. By examining the peptide's effects on renal hemodynamics and electrolyte excretion, scientists can elucidate mechanisms underlying disorders such as edema, chronic kidney disease, and acute kidney injury. The compound's ability to modulate renal function in animal models and isolated perfused kidney preparations makes it indispensable for advancing the understanding of renal pathophysiology.

Signal Transduction Pathway Analysis: As a selective natriuretic peptide receptor agonist, Ularitide is a valuable tool for dissecting cGMP-dependent signaling pathways. Its use in cell culture and tissue assays allows researchers to monitor downstream effects such as protein kinase G activation, ion channel modulation, and gene expression changes. These studies contribute to the broader understanding of how natriuretic peptides influence cellular processes beyond fluid balance, including proliferation, apoptosis, and inflammation. The compound's specificity enables precise mapping of receptor-mediated events, supporting the development of targeted interventions in cardiovascular and renal research.

Pharmacological Screening: Ularitide's defined mode of action makes it suitable for use in pharmacological screening platforms aimed at identifying novel modulators of natriuretic peptide receptors or downstream effectors. Researchers employ it as a reference compound in high-throughput assays to benchmark the efficacy and potency of new drug candidates. Its predictable pharmacodynamic profile enhances assay reliability and facilitates the comparison of experimental outcomes across different laboratories. This application accelerates the discovery and optimization of molecules that may influence natriuretic peptide signaling pathways in various disease contexts.

Preclinical Model Development: In the context of translational research, Ularitide is utilized to establish and validate animal models that mimic human cardiovascular and renal conditions. Its administration in preclinical studies helps to reproduce key features of fluid overload, hypertension, and altered renal function, enabling the evaluation of novel therapeutic strategies. The peptide's robust and reproducible biological effects support the generation of pathophysiologically relevant models, fostering the advancement of preclinical research and the refinement of experimental protocols. Through these diverse applications, Ularitide continues to be a cornerstone in the fields of cardiovascular and renal research, driving innovation and deepening scientific understanding of complex physiological systems.

Source#
Synthetic
Organism
Human
InChI
InChI=1S/C145H234N52O44S3/c1-11-72(6)112-137(238)171-60-106(208)172-73(7)113(214)177-86(40-41-103(146)205)122(223)190-95(63-198)116(217)170-61-108(210)175-88(51-70(2)3)114(215)169-62-109(211)176-100(133(234)187-92(56-104(147)206)127(228)193-97(65-200)130(231)186-91(54-77-27-16-13-17-28-77)126(227)180-82(31-20-45-163-142(153)154)119(220)189-94(139(240)241)55-78-36-38-79(204)39-37-78)68-243-244-69-101(134(235)185-90(53-76-25-14-12-15-26-76)115(216)168-58-105(207)167-59-107(209)174-80(29-18-43-161-140(149)150)117(218)182-87(42-50-242-10)123(224)188-93(57-110(212)213)128(229)181-85(124(225)196-112)34-23-48-166-145(159)160)195-132(233)99(67-202)194-131(232)98(66-201)192-120(221)83(32-21-46-164-143(155)156)178-118(219)81(30-19-44-162-141(151)152)179-125(226)89(52-71(4)5)184-129(230)96(64-199)191-121(222)84(33-22-47-165-144(157)158)183-135(236)102-35-24-49-197(102)138(239)74(8)173-136(237)111(148)75(9)203/h12-17,25-28,36-39,70-75,80-102,111-112,198-204H,11,18-24,29-35,40-69,148H2,1-10H3,(H2,146,205)(H2,147,206)(H,167,207)(H,168,216)(H,169,215)(H,170,217)(H,171,238)(H,172,208)(H,173,237)(H,174,209)(H,175,210)(H,176,211)(H,177,214)(H,178,219)(H,179,226)(H,180,227)(H,181,229)(H,182,218)(H,183,236)(H,184,230)(H,185,235)(H,186,231)(H,187,234)(H,188,224)(H,189,220)(H,190,223)(H,191,222)(H,192,221)(H,193,228)(H,194,232)(H,195,233)(H,196,225)(H,212,213)(H,240,241)(H4,149,150,161)(H4,151,152,162)(H4,153,154,163)(H4,155,156,164)(H4,157,158,165)(H4,159,160,166)/t72-,73-,74-,75+,80-,81-,82-,83-,84-,85-,86-,87-,88-,89-,90-,91-,92-,93-,94-,95-,96-,97-,98-,99-,100-,101-,102-,111-,112-/m0/s1
InChI Key
IUCCYQIEZNQWRS-DWWHXVEHSA-N
BoilingPoint
N/A
Melting Point
N/A

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
cGMP Peptide ServicePeptide Nucleic Acids SynthesisPeptide CDMOPeptide Modification ServicesEpitope Mapping ServicesPeptide Analysis ServicesPeptide Synthesis ServicesCustom Conjugation Service
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers