Ularitide
Ularitide is a synthetic form of urodilatin, a naturally occurring human natriuretic peptide that is involved in regulating blood pressure and the excretion of water and sodium from the kidneys. Urodilatin is produced in the kidney and excreted into the urine, and thus exists in low levels naturally in the systemic blood circulation. When injected into the blood, ularitide appears to cause diuresis (urine output) and natriuresis (sodium excretion), as well as vasodilation.
Online Inquiry
| CAT# | 10-101-171 |
| CAS | 118812-69-4 |
| Synonyms/Alias | Urodilatin;ularitide |
| M.F/Formula | C145H234N52O44S3 |
| M.W/Mr. | 3505.92646 |
| Sequence | TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY(Disulfide bridge cys11 and cys27) |
| Labeling Target | Atrial natriuretic peptide receptor |
| Application | Ularitide is investigated for use in congestive heart failure. |
| Areas of Interest | Cardiovascular System & Diseases |
| Functions | Protein kinase activity |
| Source# | Synthetic |
Storage | -20°C |
Organism | Human |
BoilingPoint | N/A |
Melting Point | N/A |
Write a review
Ask a question
My Review for Ularitide
Required fields are marked with *
×
Ask a Question for Ularitide
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
