Ularitide

Ularitide is a synthetic form of urodilatin, a naturally occurring human natriuretic peptide that is involved in regulating blood pressure and the excretion of water and sodium from the kidneys. Urodilatin is produced in the kidney and excreted into the urine, and thus exists in low levels naturally in the systemic blood circulation. When injected into the blood, ularitide appears to cause diuresis (urine output) and natriuresis (sodium excretion), as well as vasodilation.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: 10-101-171

CAS No:118812-69-4

Synonyms/Alias:Ularitide;Urodilatin;Urodilatin human;115966-23-9;118812-69-4;Urodilatin ularitide;ularitida;Human urodilatin;Ularitide [INN];ANP 95-126;UNII-740Y5J48Z8;DTXSID50151238;740Y5J48Z8;CDD 95-126;Thr-Ala-Pro-Arg-Atrial Natriuretic Factor (1-28) (human, bovine, porcine) trifluoroacetate salt;L-Threonyl-L-alanyl-L-prolyl-L-arginyl-L-seryl-L-leucyl-L-arginyl-L-arginyl-L-seryl-L-seryl-L-cysteinyl-L-phenylalanylglycylglycyl-L-arginyl-L-methionyl-L-aspartyl-L-arginyl-L-isoleucylglycyl-L-alanyl-L-glutaminyl-L-serylglycyl-L-leucylglycyl-L-cysteinyl-L-asparaginyl-L-seryl-L-phenylalanyl-L-arginyl-L-tyrosine cyclic (11->27)-disulfide;URODILATIN [MI];Atriopeptin (95-126);Anf (95-126);Anp (95-126);Atrial natriuretic peptide (95-126);ularitidum;Urodilatin (human);ULARITIDE [WHO-DD];CHEMBL2103920;DTXCID7073729;ESP-305;URODILATIN ULARITIDE [MI];Urodilatin human, >=97% (HPLC);AKOS030213250;AT42474;DB05034;DA-58548;DA-78761;FT108857;L-Threonyl-L-alanyl-L-prolyl-L-arginyl-L-seryl-L-leucyl-L-arginyl-L-arginyl-L-seryl-L-seryl-L-cysteinyl-L-phenylalanylglycylglycyl-L-arginyl-L-methionyl-L-aspartyl-L-arginyl-L-isoleucylglycyl-L-alanyl-L-glutaminyl-L-serylglycyl-L-leucylglycyl-L-cysteinyl-L-asparaginyl-L-seryl-L-phenylalanyl-L-arginyl-L-tyrosine cyclic (11-27)-disulfide;

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C145H234N52O44S3
M.W/Mr.
3505.9
Sequence
One Letter Code:TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY
Three Letter Code:H-Thr-Ala-Pro-Arg-Ser-Leu-Arg-Arg-Ser-Ser-Cys(1)-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys(1)-Asn-Ser-Phe-Arg-Tyr-OH
Labeling Target
Atrial natriuretic peptide receptor
Application
Ularitide is investigated for use in congestive heart failure.
Areas of Interest
Cardiovascular System & Diseases
Functions
Protein kinase activity

Ularitide is a synthetic peptide that corresponds to the human natriuretic peptide urodilatin, a member of the natriuretic peptide family involved in the regulation of fluid and electrolyte balance. As a biologically active peptide, it is derived from the precursor of atrial natriuretic peptide and is primarily expressed in the kidneys, where it plays a key role in modulating sodium excretion, diuresis, and vascular tone. Its unique mechanism of action and structural similarity to endogenous natriuretic peptides make it a valuable tool for researchers investigating renal physiology, cardiovascular signaling, and peptide-receptor interactions. The biochemical characteristics of ularitide, including its receptor specificity and downstream signaling effects, have established it as a prominent reagent in advanced peptide research and functional studies.

Renal physiology research: Ularitide serves as a critical probe for elucidating the molecular pathways governing sodium and water homeostasis in the kidney. By mimicking the action of endogenous urodilatin, it enables researchers to dissect the signaling cascades that promote natriuresis and diuresis. Its use in experimental models allows scientists to study the regulation of renal tubular function, the role of natriuretic peptide receptors, and the integration of hormonal control mechanisms that influence fluid balance and blood pressure. Such investigations contribute to a deeper understanding of renal endocrine function and the physiological adaptation to changes in volume status.

Peptide-receptor interaction studies: The compound is extensively employed in characterizing the binding affinity and specificity of natriuretic peptides to their cognate receptors, particularly the natriuretic peptide receptor-A (NPR-A). By serving as a defined ligand in receptor binding assays, ularitide facilitates the mapping of receptor activation, downstream cyclic GMP production, and the modulation of intracellular signaling pathways. These studies are essential for delineating the structural determinants of receptor-ligand interactions and for screening potential modulators of natriuretic peptide signaling.

Cardiovascular signaling investigations: Ularitide is utilized to explore the broader impact of natriuretic peptides on vascular tone, endothelial function, and cardiac load. In vitro and ex vivo models benefit from its ability to induce vasodilation and modulate vascular smooth muscle cell activity, providing insights into the mechanisms underlying blood pressure regulation and vascular homeostasis. By enabling precise manipulation of natriuretic peptide pathways, the compound aids in clarifying the interplay between renal and cardiovascular systems at the molecular level.

Peptide synthesis and analytical validation: As a synthetic analog of urodilatin, ularitide is frequently used as a reference standard in peptide synthesis, purification, and analytical method development. Its defined sequence and established bioactivity make it suitable for validating chromatographic techniques, mass spectrometry protocols, and quality control assays in peptide manufacturing and research settings. The availability of this peptide supports the development of robust analytical workflows for the characterization of related natriuretic peptides and their derivatives.

Signal transduction pathway analysis: The compound is a valuable tool for dissecting the downstream cellular events triggered by natriuretic peptide receptor activation. Researchers use ularitide to stimulate intracellular cyclic GMP production and to monitor subsequent effects on protein kinases, ion channels, and gene expression profiles. Such studies are instrumental in unraveling the complex network of signaling events that contribute to the physiological actions of natriuretic peptides and in identifying novel regulatory nodes within these pathways.

Source#
Synthetic
Organism
Human
InChI
InChI=1S/C145H234N52O44S3/c1-11-72(6)112-137(238)171-60-106(208)172-73(7)113(214)177-86(40-41-103(146)205)122(223)190-95(63-198)116(217)170-61-108(210)175-88(51-70(2)3)114(215)169-62-109(211)176-100(133(234)187-92(56-104(147)206)127(228)193-97(65-200)130(231)186-91(54-77-27-16-13-17-28-77)126(227)180-82(31-20-45-163-142(153)154)119(220)189-94(139(240)241)55-78-36-38-79(204)39-37-78)68-243-244-69-101(134(235)185-90(53-76-25-14-12-15-26-76)115(216)168-58-105(207)167-59-107(209)174-80(29-18-43-161-140(149)150)117(218)182-87(42-50-242-10)123(224)188-93(57-110(212)213)128(229)181-85(124(225)196-112)34-23-48-166-145(159)160)195-132(233)99(67-202)194-131(232)98(66-201)192-120(221)83(32-21-46-164-143(155)156)178-118(219)81(30-19-44-162-141(151)152)179-125(226)89(52-71(4)5)184-129(230)96(64-199)191-121(222)84(33-22-47-165-144(157)158)183-135(236)102-35-24-49-197(102)138(239)74(8)173-136(237)111(148)75(9)203/h12-17,25-28,36-39,70-75,80-102,111-112,198-204H,11,18-24,29-35,40-69,148H2,1-10H3,(H2,146,205)(H2,147,206)(H,167,207)(H,168,216)(H,169,215)(H,170,217)(H,171,238)(H,172,208)(H,173,237)(H,174,209)(H,175,210)(H,176,211)(H,177,214)(H,178,219)(H,179,226)(H,180,227)(H,181,229)(H,182,218)(H,183,236)(H,184,230)(H,185,235)(H,186,231)(H,187,234)(H,188,224)(H,189,220)(H,190,223)(H,191,222)(H,192,221)(H,193,228)(H,194,232)(H,195,233)(H,196,225)(H,212,213)(H,240,241)(H4,149,150,161)(H4,151,152,162)(H4,153,154,163)(H4,155,156,164)(H4,157,158,165)(H4,159,160,166)/t72-,73-,74-,75+,80-,81-,82-,83-,84-,85-,86-,87-,88-,89-,90-,91-,92-,93-,94-,95-,96-,97-,98-,99-,100-,101-,102-,111-,112-/m0/s1
InChI Key
IUCCYQIEZNQWRS-DWWHXVEHSA-N
BoilingPoint
N/A
Melting Point
N/A

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Analysis ServicesPeptide CDMOPeptide Modification ServicesEpitope Mapping ServicesCustom Conjugation ServicePeptide Synthesis ServicescGMP Peptide ServicePeptide Nucleic Acids Synthesis
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers