Urocortin III, mouse is a corticotropin-releasing factor (CRF)-related peptide. Urocortin III preferentially binds and activates CRF-R2.
CAT No: R1739
CAS No:357952-10-4
Synonyms/Alias:CHEMBL518546;FU109627;Urocortin III (mouse) trifluoroacetate salt;357952-10-4;H-Phe-Thr-Leu-Ser-Leu-Asp-Val-Pro-Thr-Asn-Ile-Met-Asn-Ile-Leu-Phe-Asn-Ile-Asp-Lys-Ala-Lys-Asn-Leu-Arg-Ala-Lys-Ala-Ala-Ala-Asn-Ala-Gl n-Leu-Met-Ala-Gln-Ile-NH2; H-FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2;
Urocortin III, mouse is a synthetic peptide corresponding to the endogenous mouse Urocortin III, a member of the corticotropin-releasing factor (CRF) peptide family. Distinguished by its selective affinity for the corticotropin-releasing factor receptor type 2 (CRF2), this neuropeptide plays a pivotal role in the modulation of stress responses, energy balance, and neuroendocrine signaling in mammalian systems. Its unique receptor specificity and sequence conservation across species have made it a valuable molecular tool for dissecting CRF-mediated pathways and for advancing the understanding of peptide-receptor interactions in neurobiology and endocrinology research.
Receptor pharmacology: Urocortin III is widely employed in receptor binding assays and functional studies to characterize the pharmacological properties of CRF2 receptors. By serving as a selective agonist, it enables researchers to delineate the signaling cascades and physiological responses specifically mediated by CRF2, distinguishing these from those triggered by CRF1 activation. This specificity facilitates the investigation of receptor-ligand dynamics, downstream effector pathways, and the development of receptor subtype-selective modulators.
Neuroendocrine research: The peptide is instrumental in elucidating the roles of CRF-related signaling in the central nervous system, particularly in the context of hypothalamic-pituitary-adrenal (HPA) axis regulation. Studies utilizing Urocortin III have provided insights into the mechanisms underlying stress adaptation, emotional behavior, and neuroendocrine homeostasis. Its application in in vitro and in vivo experimental models allows for precise manipulation of CRF2-mediated responses, supporting the exploration of neuropeptide function in both physiological and pathophysiological states.
Peptide structure-function analysis: As a well-defined CRF family peptide, Urocortin III supports investigations into peptide structure-activity relationships. Researchers utilize it as a template for mutagenesis studies, synthetic analog development, and conformational analysis to better understand the determinants of receptor selectivity and biological activity. These studies contribute to the rational design of novel peptide ligands with tailored pharmacological profiles and improved stability for research applications.
Peptide synthesis and assay validation: Urocortin III serves as a reference standard in peptide synthesis optimization and analytical method development. Its well-characterized sequence and bioactivity make it an ideal positive control in chromatographic and mass spectrometric assays, as well as in cell-based functional assays measuring CRF2 receptor activation. This facilitates assay calibration, method validation, and quality control in peptide research and production workflows.
Metabolic and physiological studies: The selective CRF2 agonist properties of Urocortin III are leveraged in research exploring metabolic regulation, appetite control, and cardiovascular function. By selectively activating CRF2 pathways, it enables the dissection of neuropeptide-mediated effects on energy expenditure, feeding behavior, and autonomic responses. Such studies provide a foundation for understanding the physiological integration of stress, metabolism, and cardiovascular regulation at the molecular and systemic levels.
2. Implications of ligand-receptor binding kinetics on GLP-1R signalling
3. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.
From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.