Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | GIWSSIKNLASKAWNSDIGQSLRNKAAGAINKFVADKIGVTPSQAASMTLDEIVDAMYYD |
Activity | Gram-, Mammalian cells, |
Host Chemicals | the scorpion venom, Vaejovis mexicanus |
Length | 60 |
1. Immune responses to homocitrulline-and citrulline-containing peptides in rheumatoid arthritis
2. Cationic cell-penetrating peptides are potent furin inhibitors
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.