CAT# | AF3334 |
Sequence | GIWSSIKNLASKAWNSDIGQSLRNKAAGAINKFVADKIGVTPSQAASMTLDEIVDAMYYD |
Activity | Gram-, Mammalian cells, |
Host Chemicals | the scorpion venom, Vaejovis mexicanus | Length | 60 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF936 | Nigrocin-1-OA2 | Inquiry | ||
AF1602 | Bombinin-like peptides 1 | Inquiry | ||
AF008 | Cyclopeptide E | Inquiry | ||
AF990 | Andersonin-S peptide precursor | Inquiry | ||
AF1761 | Odorranain-F1 antimicrobial peptide | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Palmitoyl Tripeptide-38, named MATRIXYL synthe'6 and Volulip, a cosmetic peptide or double-oxidized lipopeptide, ...
DAPTA (D-[Ala]-Ser-Thr-Thr-Thr-Asn-Tyr-Thr-amide), D-Ala-Peptide T amide, is one of analogue of peptide T, which ...
Dulaglutide, sold under the brand name Trulicity, is a GLP-1 receptor agonist which is a class of medications th ...
Iron chelating agent is a new type of iron-removing treatment based on the combination of directional and in viv ...
Gap 19 is a nonapeptide derived from the cytoplasmic loop (CL) of Connexin-43 (Cx43). Cx43 is a predominant card ...