Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | GIPCGESCVFIPCISSVIGCSCSSKVCYRN |
Activity | Antimicrobial |
Host Chemicals | Viola philippica |
Length | 30 |
1. Myotropic activity of allatostatins in tenebrionid beetles
3. Cell-based adhesion assays for isolation of snake venom’s integrin antagonists
5. Emerging applications of nanotechnology for diagnosis and therapy of disease: a review
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.