VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is a synthetic peptide of defined sequence, designed to facilitate advanced research in peptide biochemistry, molecular biology, and protein interaction studies. As a custom peptide, it offers a precise primary structure that enables researchers to probe specific biochemical processes, investigate sequence-dependent phenomena, and develop new assay systems. The unique amino acid composition and sequence arrangement of this peptide make it a valuable tool for elucidating the roles of short linear motifs, mapping protein-protein interactions, and supporting the development of peptide-based technologies. Its versatility and high degree of structural definition allow for a broad range of experimental applications in both academic and industrial research settings.

Peptide mapping: In proteomics and structural biology, this synthetic peptide can serve as a standard or probe in peptide mapping experiments. By incorporating VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS into analytical workflows, researchers can calibrate mass spectrometry instruments, validate chromatographic methods, or benchmark peptide identification algorithms. The defined sequence provides a reliable reference for optimizing peptide separation, detection, and quantification, thereby supporting accurate characterization of complex protein mixtures and facilitating method development in analytical laboratories.

Protein-protein interaction studies: The peptide sequence is well-suited for use as a bait or probe in assays designed to elucidate protein-protein interactions. By immobilizing or labeling the peptide, scientists can investigate binding affinities, map interaction domains, and screen for potential binding partners within cellular extracts or purified protein samples. Such studies help clarify the molecular determinants of recognition and specificity, contributing to the broader understanding of signaling pathways, regulatory networks, and protein complex assembly.

Antibody epitope characterization: Researchers can utilize this synthetic peptide to map and validate antibody binding sites, particularly when studying sequence-specific recognition events. By employing the peptide in enzyme-linked immunosorbent assays (ELISA), western blotting, or immunoprecipitation protocols, it becomes possible to determine the specificity and affinity of monoclonal or polyclonal antibodies. This approach aids in the development of high-quality immunoreagents and enhances the reliability of immunodetection techniques in basic and applied research.

Peptide functionalization and conjugation: The defined structure of VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS allows it to be readily modified or conjugated to various functional groups, fluorescent tags, or carrier molecules. Such functionalization is essential for applications in biosensor development, affinity purification, and targeted delivery systems. By tailoring the peptide for specific experimental needs, researchers can expand its utility across diverse platforms, from microarray fabrication to the engineering of novel bioconjugates for in vitro studies.

Enzyme substrate or inhibitor studies: The peptide can be employed as a substrate or competitive inhibitor in enzymatic assays, particularly for proteases or post-translational modification enzymes that recognize specific sequence motifs. By monitoring cleavage, modification, or binding events, scientists can dissect enzyme specificity, catalytic efficiency, and regulatory mechanisms. These insights are valuable for the characterization of enzyme function, the screening of modulators, and the development of new biochemical assays that rely on defined peptide substrates.

1. Spatiotemporal delivery of nanoformulated liraglutide for cardiac regeneration after myocardial infarction

2. Effect of Probiotic Lactobacillus plantarum on Streptococcus mutans and Candida albicans Clinical Isolates from Children with Early Childhood Caries

3. Cell-based adhesion assays for isolation of snake venom’s integrin antagonists

4. Low bone turnover and low BMD in Down syndrome: effect of intermittent PTH treatment

5. Relatedness of antibodies to peptides containing homocitrulline or citrulline in patients with rheumatoid arthritis