Keywords Search Google Search Search

VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is the first N-terminal 1-28 residues of Exendin-4 peptide.

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	R1751
M.W/Mr.	3241.70
Sequence	One Letter Code: VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS three Letter Code: Val-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser

CAT#	Product Name	Inquiry
R0974	AP 811	Inquiry
R1511	Melanotan (MT)-II	Inquiry
R1879	Acetyl-Pepstatin	Inquiry
R1296	Colivelin TFA	Inquiry
HB00041	Biotin-AEVD-FMK	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

What is GHK and Copper Peptide?

Background Signal peptides stimulate matrix protein production in general and collagen synthesis in specific. They may be acc ...

Huwentoxin IV, A Kind of Selective NaV1.7 Channel Blocker

Huwentoxin IV, a 35-amino-acid-residue polypeptide from Chinese tarantula Ornithoctonus huwena venom, is a kind ...

Function of D15 As An Endocytosis Inhibitor

The endocytosis of AMPA receptors (AMPARs) requires the GTPase activity of dynamin. Since it is now established ...

Function of Huwentoxin-XVI in analgesia

Ornithoctonus huwena, Chinese tarantula, is one of the most venomous spiders in China, and its venom can kill in ...

Function of Mifamurtide in Osteosarcoma

The immunomodulator mifamurtide (liposomal muramyltripeptide phosphatidyl ethanolamine [L-MTP-PE]) is a syntheti ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: