VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is the first N-terminal 1-28 residues of Exendin-4 peptide.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R1751

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.W/Mr.
3241.70
Sequence
One Letter Code: VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
three Letter Code: Val-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser

VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is a synthetic peptide of defined sequence, designed to facilitate advanced research in peptide biochemistry, molecular biology, and protein interaction studies. As a custom peptide, it offers a precise primary structure that enables researchers to probe specific biochemical processes, investigate sequence-dependent phenomena, and develop new assay systems. The unique amino acid composition and sequence arrangement of this peptide make it a valuable tool for elucidating the roles of short linear motifs, mapping protein-protein interactions, and supporting the development of peptide-based technologies. Its versatility and high degree of structural definition allow for a broad range of experimental applications in both academic and industrial research settings.

Peptide mapping: In proteomics and structural biology, this synthetic peptide can serve as a standard or probe in peptide mapping experiments. By incorporating VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS into analytical workflows, researchers can calibrate mass spectrometry instruments, validate chromatographic methods, or benchmark peptide identification algorithms. The defined sequence provides a reliable reference for optimizing peptide separation, detection, and quantification, thereby supporting accurate characterization of complex protein mixtures and facilitating method development in analytical laboratories.

Protein-protein interaction studies: The peptide sequence is well-suited for use as a bait or probe in assays designed to elucidate protein-protein interactions. By immobilizing or labeling the peptide, scientists can investigate binding affinities, map interaction domains, and screen for potential binding partners within cellular extracts or purified protein samples. Such studies help clarify the molecular determinants of recognition and specificity, contributing to the broader understanding of signaling pathways, regulatory networks, and protein complex assembly.

Antibody epitope characterization: Researchers can utilize this synthetic peptide to map and validate antibody binding sites, particularly when studying sequence-specific recognition events. By employing the peptide in enzyme-linked immunosorbent assays (ELISA), western blotting, or immunoprecipitation protocols, it becomes possible to determine the specificity and affinity of monoclonal or polyclonal antibodies. This approach aids in the development of high-quality immunoreagents and enhances the reliability of immunodetection techniques in basic and applied research.

Peptide functionalization and conjugation: The defined structure of VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS allows it to be readily modified or conjugated to various functional groups, fluorescent tags, or carrier molecules. Such functionalization is essential for applications in biosensor development, affinity purification, and targeted delivery systems. By tailoring the peptide for specific experimental needs, researchers can expand its utility across diverse platforms, from microarray fabrication to the engineering of novel bioconjugates for in vitro studies.

Enzyme substrate or inhibitor studies: The peptide can be employed as a substrate or competitive inhibitor in enzymatic assays, particularly for proteases or post-translational modification enzymes that recognize specific sequence motifs. By monitoring cleavage, modification, or binding events, scientists can dissect enzyme specificity, catalytic efficiency, and regulatory mechanisms. These insights are valuable for the characterization of enzyme function, the screening of modulators, and the development of new biochemical assays that rely on defined peptide substrates.

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Modification ServicescGMP Peptide ServicePeptide Synthesis ServicesPeptide Analysis ServicesEpitope Mapping ServicesCustom Conjugation ServicePeptide CDMOPeptide Nucleic Acids Synthesis
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers