w-Agatoxin-TK

w-Agatoxin-TK is a cone-snail peptide notable for its cysteine framework, forming a knotted fold essential for channel-binding studies. The rigid architecture supports evaluation of gating-modulation mechanisms. Aromatic residues enhance structural stability. Researchers apply it in evolutionary, electrophysiological, and biophysical investigations.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: C27008

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C215H337N65O70S10
M.W/Mr.
5273.1
Sequence
EDNCIAEDYGKCTWGGTKCCRGRPCRCSMIGTNCECTPRLIMEGLSFA
Length
48

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
cGMP Peptide ServicePeptide Nucleic Acids SynthesisCustom Conjugation ServicePeptide Analysis ServicesPeptide Modification ServicesPeptide Synthesis ServicesPeptide CDMOEpitope Mapping Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers