CAT# | C27008 |
M.F/Formula | C215H337N65O70S10 |
M.W/Mr. | 5273.1 |
Sequence | EDNCIAEDYGKCTWGGTKCCRGRPCRCSMIGTNCECTPRLIMEGLSFA |
Length | 48 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
C27004 | Alpha-conotoxin GIA | Inquiry | ||
C27007 | a-Conotoxin IMI | Inquiry | ||
C27012 | μ-Conotoxin GIIIA | Inquiry | ||
C27010 | Biotinyl-EpsilonAhx-Omega-Conotoxin GVIA | Inquiry | ||
C27002 | ω-Conotoxin MVIIC | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
of Tripeptide-1 The tripeptide-1 (glycyl-L-histadyl-L-lysine or GHK) is primarily known as carrier peptides. It ...
Gonadorelin is a synthetic GnRH, a peptide compound, and a decapeptide whose structure is exactly the same as th ...
TC 14012 is a serum-stable derivative of the peptidomimetic T140, which is a cyclic peptide with the structure o ...
PT-141, also called as Bremelanotide, is a derivative for Melanotan 2 (M2). Unlike M2, PT-141 lacks C-terminal a ...
MEN 10376 (Asp-Tyr-D-Trp-Val-D-Trp-D-Trp-Lys-NH2) is an analogue of Neurokinin A (NKA), which has a selective af ...