Home > Product > Catalog Peptides > Others > w-Agatoxin-TK

Others

w-Agatoxin-TK

Price Inquiry
CAT#
C27008
Sequence
EDNCIAEDYGKCTWGGTKCCRGRPCRCSMIGTNCECTPRLIMEGLSFA
M.W/Mr.
5273.1
Molecular Formula
C215H337N65O70S10
Length
48

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.