CAT# | B11005 |
Sequence | LEAAMRDLDSFEHPEEASEKETRGFNQEEKE |
Length | 31 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
X10200 | PM_19631530 | Inquiry | ||
X02640 | PM_10453018 | Inquiry | ||
X20031 | UP_P83853 | Inquiry | ||
X21099 | WFGVS_multorg | Inquiry | ||
X10495 | PM_20106520 | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Eledoisin is an undecapeptite of mollusk origin, which was first separated from posterior salivary glands of two ...
Figure 1. The structural formula of ornipressinOrnipressin is a synthetic analogue of vasopressin, which is repl ...
Somatostatin (SST) is a peptide compound synthesized by neuroendocrine cells and other cells that can label tumo ...
Guangxitoxin 1E is a KV2.1 and KV2.2 specific channel blocker (IC50 values are 1-3 nM). The experimental results ...
Angiotensin Ⅱ is a kind of peptides generally produced by the hydrolysis of the angiotensin Ⅰ under the angioten ...