Keywords Search Google Search Search

ACTH (1-39), guinea pig

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	A03024
M.F/Formula	C206H308N56O58S
M.W/Mr.	4529.2
Sequence	SYSMEHFRWGKPVGKKRRPVKVYANGAEEESAEAFPLEF

CAT#	Product Name	Inquiry
A03035	ACTH (7-38), human	Inquiry
A03014	Acetyl-ACTH (7-24) (human, bovine, rat)	Inquiry
A03044	(Des-Glu⁵)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt	Inquiry
A03027	ACTH (18-39), human (CLIP)	Inquiry
A03038	Endo-4a-Glu-ACTH (1-24) (human, bovine, rat)	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

The effect of thymopentin in the treatment of chronic severe viral hepatitis B

The thymopentin is a small peptide consisting of 5 amino acid residues (Arg-Lys-Asp-Val-Tyr) from thymosin. It h ...

Novel Peptide Drugs to Treat Multiple Diseases (Part Two)

5. Synthetic Peptides Targeting CD36 Attenuate Lipopolysaccharide-Induced InflammationSynthetic amphipathic helical peptides ...

Function of Gonadorelin Acetate in Central Precocious Puberty

Gonadorelin acetate, a synthetic decapeptide with sequence Glp-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2, is a gon ...

MC1R antagonist-MSG 606

MSG 606 (Cyclo-[(CH2) 3CO-Gly-His-D-Phe-Arg-D-Trp-Cys(S-)]-Asp-Arg-Phe-Gly-NH2) is a potent and novel cyclic thi ...

Function of Hexanoyl Dipeptide-3 Norleucine Acetate in Human Skin

Foreword We live in a photoshopped world, where we are constantly updated by images of digital perfection. It's easy to becom ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: