Adrenomedullin (AM) (1-52), human TFA

Adrenomedullin (AM) (1-52), human (TFA) affects cell proliferation and angiogenesis in cancer.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R1174

Synonyms/Alias:Human adrenomedullin-(1-52)-NH2 (TFA)

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C₂₆₆H₄₀₇F₃N₈₀O₇₉S₃
M.W/Mr.
6142.76
Sequence
One Letter Code: YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 (Disulfide bridge: Cys16-Cys21)
three Letter Code: Tyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Leu-Arg-Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (Disulfide bridge: Cys16-Cys21)

Adrenomedullin (AM) (1-52), human TFA is a synthetic peptide corresponding to the full-length, biologically active human adrenomedullin sequence with a trifluoroacetate (TFA) counterion. As a multifunctional peptide hormone, it plays a pivotal role in the regulation of vascular tone, angiogenesis, and fluid homeostasis. Its distinctive structure, characterized by a 52-amino acid chain with an amidated C-terminus and an internal disulfide bond, underpins its interaction with specific G protein-coupled receptors, notably the calcitonin receptor-like receptor (CLR) complexed with receptor activity-modifying proteins (RAMPs). The molecule's physiological and pathophysiological relevance has made it a subject of intense investigation in cardiovascular, renal, and inflammatory research, as well as in studies dissecting peptide-receptor signaling.

Peptide signaling studies: As a prototypical member of the adrenomedullin peptide family, this compound is extensively utilized to elucidate the molecular mechanisms underlying peptide-mediated cell signaling. Researchers employ it to activate CLR/RAMP receptor complexes in cultured cells, vascular tissue preparations, and animal models, enabling detailed characterization of downstream signaling cascades such as cAMP production, nitric oxide synthesis, and MAP kinase activation. These experiments provide critical insights into the role of peptide hormones in vascular biology and broader aspects of cell communication.

Vascular biology research: The peptide's established function as a potent vasodilator makes it an essential tool for examining the regulation of vascular tone, endothelial function, and smooth muscle cell behavior. By applying it to isolated vessel preparations or in vitro endothelial cell systems, investigators can study acute and chronic responses to peptide stimulation, including modulation of vascular permeability, resistance, and angiogenic potential. Such studies are instrumental in advancing the understanding of adaptive and maladaptive vascular responses in health and disease.

Peptide-receptor interaction assays: The well-defined structure and receptor specificity of this peptide enable its use as a reference ligand in binding affinity and receptor activation assays. It serves as a standard for competitive binding experiments, receptor profiling, and structure-activity relationship analyses. These applications facilitate the identification and characterization of novel peptide analogs, antagonists, or allosteric modulators, contributing to the broader field of peptide-receptor pharmacology and drug discovery.

Inflammation and immune modulation studies: The regulatory effects of this peptide on cytokine production, leukocyte migration, and endothelial barrier integrity have positioned it as a valuable probe in inflammation research. Experimental models employing the peptide are used to dissect the molecular interplay between peptide hormones and immune cell function, supporting investigations into the mechanisms of vascular inflammation, tissue edema, and immune cell trafficking.

Peptide synthesis and analytical method development: The defined sequence and physicochemical properties of adrenomedullin (1-52) make it a useful standard in peptide synthesis optimization and quality control. It is applied as a calibration standard in chromatographic and mass spectrometric analyses, supporting the validation of peptide purification protocols and analytical methods. These technical applications ensure the reliability and reproducibility of peptide-based research and manufacturing workflows.

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
cGMP Peptide ServicePeptide Nucleic Acids SynthesisPeptide CDMOPeptide Modification ServicesPeptide Synthesis ServicesEpitope Mapping ServicesPeptide Analysis ServicesCustom Conjugation Service
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers