Adrenomedullin (AM) (22-52), human is an adrenomedullin receptor antagonist, and also antagonizes the calcitonin generelated peptide (CGRP) receptor in the hindlimb vascular bed of the cat.
CAT No: R1175
CAS No: 159899-65-7
Synonyms/Alias: 22-52-Adrenomedullin (human)
Quick InquiryCustom Peptide SynthesisPeptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C₁₅₉H₂₅₂N₄₆O₄₈ |
M.W/Mr. | 3576.04 |
Sequence | One Letter Code: TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 three Letter Code: Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 |
Source# | Synthetic |
2. Myotropic activity of allatostatins in tenebrionid beetles
5. C-Peptide replacement therapy and sensory nerve function in type 1 diabetic neuropathy
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.