Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C235H362N76O67S11 |
M.W/Mr. | 5676.6 |
Sequence | One Letter Code:SSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT-NH2 (Disulfide bridge: Cys1-Cys4; Cys2-Cys6; Cys3-Cys9; Cys5-Cys10; Cys7-Cys8) Three Letter Code:Ser-Ser-Arg-Arg-Cys-Val-Arg-Leu-His-Glu-Ser-Cys-Leu-Gly-Gln-Gln-Val-Pro-Cys-Cys-Asp-Pro-Cys-Ala-Thr-Cys-Tyr-Cys-Arg-Phe-Phe-Asn-Ala-Phe-Cys-Tyr-Cys-Arg-Lys-Leu-Gly-Thr-Ala-Met-Asn-Pro-Cys-Ser-Arg-Thr-NH2 (Disulfide bridge: Cys1-Cys4; Cys2-Cys6; Cys3-Cys9; Cys5-Cys10; Cys7-Cys8) |
1. Immune-awakening Saccharomyces-inspired nanocarrier for oral target delivery to lymph and tumors
3. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
Required fields are marked with *
×Required fields are marked with *
×If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.