Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | FTMKKSLLLLFFLGTINLSLCEQERNAEEERRDDLGERQAEVEKR |
Activity | Antimicrobial |
Host Chemicals | Amolops loloensis |
Length | 45 |
SwissProt ID | C5H3Z4 |
1. An Open-label, Single-center, Safety and Efficacy Study of Eyelash Polygrowth Factor Serum
3. The spatiotemporal control of signalling and trafficking of the GLP-1R
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.