Amyloid β Peptide (42-1)(human)
Amyloid β Peptide (42-1)(human)
Amyloid β Peptide (42-1)(human) is the inactive form of Amyloid β Peptide (1-42). Amyloid β Peptide (42-1) is a 42-amino acid peptide which plays a key role in the pathogenesis of Alzheimer disease.
Online Inquiry
| CAT# | R1191 |
| CAS | 317366-82-8 |
| M.F/Formula | C₂₀₃H₃₁₁N₅₅O₆₀S |
| M.W/Mr. | 4514.04 |
| Sequence | One Letter Code: AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
three Letter Code: Ala-Ile-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp |
Write a review
Ask a question
My Review for Amyloid β Peptide (42-1)(human)
Required fields are marked with *
×
Ask a Question for Amyloid β Peptide (42-1)(human)
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
