Keywords Search Google Search Search

Amyloid Precursor Protein (APP) (741-770)

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	A13220
M.W/Mr.	3646.1
Sequence	AVTPEERHLSKMQQNGYENPTYKFFEQMQN

CAT#	Product Name	Inquiry
Q0801	(Asn670,Leu671)-Amyloid β/A4 Protein Precursor770(667-676)	Inquiry
A13152	Amyloid Precursor N-Terminal Peptide	Inquiry
A13098	Amyloid Precursor-Like Protein 2, APLP2 (706-721)	Inquiry
Q0802	(Asn670,Leu671)-Amyloid β/A4 Protein Precursor770(667-675)	Inquiry
A13101	Amyloid Precursor-Like Protein 1, APLP1 (594-670)	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of Gonadorelin Acetate in Central Precocious Puberty

Gonadorelin acetate, a synthetic decapeptide with sequence Glp-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2, is a gon ...

The Function of Depreotide in Tumor Receptor Imaging

Somatostatin (SST) is a peptide compound synthesized by neuroendocrine cells and other cells that can label tumo ...

Delcasertib: A Novel δ-Protein Kinase C Inhibitor

Delcasertib, also known as KAI-9803, is a 23-amino acid peptide and δ-protein kinase C (δ-PKC) inhibitor. KAI-9 ...

Atosiban Gives Preterm Labor A Maintenance Treatment

This article will give a brief introduction about atosiban and focus on its role played in the treatment of pret ...

Bovine Pancreatic Trypsin Inhibitor (BPTI)-Aprotinin

Aprotinin is a natural proteinase inhibitor polypeptide derived from bovine lung tissue. It is a monomeric glo ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: