Home > Product > Catalog Peptides > Amyloid (APP) Precursor 770 Fragments > Amyloid Precursor Protein (APP) (741-770)

Amyloid (APP) Precursor 770 Fragments

Amyloid Precursor Protein (APP) (741-770)

Price Inquiry
CAT#
A13220
Sequence
AVTPEERHLSKMQQNGYENPTYKFFEQMQN
M.W/Mr.
3646.1
Length
30

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.