Registration of APIs CMC information required for an IND
IND and NDA support Drug master files (DMF) filing
Sequence | YQVEGMKSDVICADIRFTVHCICNELGRFPTARLTKPCPWPNRE |
Length | 44 |
Modifications | Disulfide bond |
4. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
5. TMEM16F and dynamins control expansive plasma membrane reservoirs
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us. We will endeavor to provide highly satisfying products and services.