APTSTAT3-9R

APTSTAT3-9R combines a STAT3-targeting aptide sequence with a nona-arginine translocation motif. High cationic density promotes efficient uptake, while the targeting segment binds structured STAT3 domains. Researchers evaluate its conformational stability and inhibitory potential. Applications include signaling-pathway analysis, peptide-based inhibition, and nuclear-localization studies.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R2775

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C223H330N80O51
M.W/Mr.
4947.51
Sequence
One Letter Code:HGFQWPGSWTWENGKWTWKGAYQFLKGGGGSRRRRRRRRR
Three Letter Code:{Fluorescein-5-carbonyl}-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH

APTSTAT3-9R is a specialized peptide-carbohydrate conjugate designed to facilitate targeted molecular interactions in advanced research settings. Featuring a unique structure that combines a STAT3-inhibitory peptide with a cell-penetrating 9-arginine (9R) sequence, this compound offers enhanced cellular uptake and efficient intracellular delivery. Its innovative design allows researchers to modulate key signaling pathways with high specificity, making it a valuable tool in the study of cellular processes and molecular mechanisms. The versatility of APTSTAT3-9R stems from its ability to cross cellular membranes and interact with intracellular proteins, thereby enabling precise modulation of biological functions. Its robust performance in various experimental models underscores its significance in both fundamental research and applied sciences.

Signal Transduction Research: In the field of signal transduction, APTSTAT3-9R serves as a powerful inhibitor of STAT3 activity, allowing scientists to dissect the intricacies of the JAK/STAT pathway. By blocking STAT3 phosphorylation and dimerization, the peptide-carbohydrate conjugate disrupts downstream gene expression regulated by this transcription factor. Researchers utilize the compound to elucidate STAT3's role in cellular proliferation, differentiation, and survival, thereby gaining insights into the broader landscape of intracellular signaling networks. This targeted inhibition aids in mapping out the consequences of STAT3 dysregulation in various biological contexts, providing a clearer understanding of its functional relevance.

Cancer Biology Studies: The use of APTSTAT3-9R in cancer biology has proven instrumental for investigating the molecular underpinnings of tumorigenesis. By selectively inhibiting STAT3-driven transcriptional programs, the compound enables the examination of oncogenic processes such as cell cycle progression, apoptosis resistance, and metastasis. Its efficient cellular uptake ensures that experimental outcomes accurately reflect the impact of STAT3 modulation within the tumor microenvironment. Through these studies, researchers can identify critical nodes in cancer signaling networks and explore novel strategies for disrupting aberrant cellular pathways associated with malignancy.

Immunology and Inflammation Research: The STAT3-9R peptide is a valuable asset for immunology laboratories aiming to unravel the complexities of immune cell signaling. Given STAT3's pivotal role in mediating cytokine responses and immune cell differentiation, the compound is widely applied to investigate the regulation of inflammatory processes. By inhibiting STAT3 activity in immune cells, scientists can assess the impact on cytokine production, immune tolerance, and inflammatory mediator expression. These applications contribute to a deeper understanding of immune regulation and the molecular basis of inflammatory diseases, supporting the development of targeted research interventions.

Stem Cell and Developmental Biology: In stem cell research, the peptide-carbohydrate conjugate is employed to probe the involvement of STAT3 in maintaining pluripotency and guiding differentiation. By modulating STAT3 signaling, researchers can manipulate stem cell fate decisions and investigate the transcriptional networks governing self-renewal and lineage commitment. The compound's ability to penetrate diverse cell types allows for its use in both embryonic and adult stem cell models, facilitating studies that advance knowledge of developmental processes and regenerative biology.

Neuroscience and Neuroprotection: APTSTAT3-9R finds application in neuroscience research where the modulation of STAT3 signaling is critical for understanding neuronal survival, neuroinflammation, and neurogenesis. By delivering the inhibitory peptide into neural cells, investigators can delineate the role of STAT3 in neuroprotective pathways and synaptic plasticity. This capability is particularly valuable for exploring mechanisms underlying neural injury, repair, and neurodegenerative conditions, providing a molecular handle for dissecting complex neural responses to physiological and pathological stimuli.

Overall, APTSTAT3-9R stands out as a multifaceted research tool, enabling the precise modulation of STAT3 signaling across a spectrum of scientific disciplines. Its unique combination of a cell-penetrating sequence and a STAT3-inhibitory domain allows for effective intracellular delivery and targeted action, making it indispensable for studies in signal transduction, cancer biology, immunology, stem cell research, and neuroscience. By leveraging its capabilities, researchers gain access to new experimental possibilities, advancing the frontiers of molecular and cellular biology.

InChI
InChI=1S/C223H330N80O51/c1-116(2)88-156(200(339)278-141(52-22-25-75-224)185(324)268-107-174(314)265-105-172(312)264-106-173(313)266-108-176(316)276-166(113-304)208(347)287-150(61-34-84-256-221(243)244)195(334)285-148(59-32-82-254-219(239)240)193(332)283-146(57-30-80-252-217(235)236)191(330)281-144(55-28-78-250-215(231)232)189(328)280-145(56-29-79-251-216(233)234)190(329)282-147(58-31-81-253-218(237)238)192(331)284-149(60-33-83-255-220(241)242)194(333)286-151(62-35-85-257-222(245)246)196(335)291-155(214(353)354)63-36-86-258-223(247)248)293-203(342)159(90-121-40-10-7-11-41-121)294-197(336)152(69-72-169(228)309)289-202(341)158(91-122-65-67-129(308)68-66-122)292-183(322)117(3)273-175(315)109-269-186(325)142(53-23-26-76-225)279-204(343)160(92-123-99-259-136-47-17-12-42-130(123)136)298-211(350)181(118(4)306)301-206(345)162(94-125-101-261-138-49-19-14-44-132(125)138)295-188(327)143(54-24-27-77-226)274-177(317)111-270-187(326)164(98-171(230)311)297-198(337)154(71-74-180(320)321)290-205(344)161(93-124-100-260-137-48-18-13-43-131(124)137)299-212(351)182(119(5)307)302-207(346)163(95-126-102-262-139-50-20-15-45-133(126)139)296-209(348)167(114-305)277-179(319)112-271-210(349)168-64-37-87-303(168)213(352)165(96-127-103-263-140-51-21-16-46-134(127)140)300-199(338)153(70-73-170(229)310)288-201(340)157(89-120-38-8-6-9-39-120)275-178(318)110-267-184(323)135(227)97-128-104-249-115-272-128/h6-21,38-51,65-68,99-104,115-119,135,141-168,181-182,259-263,304-308H,22-37,52-64,69-98,105-114,224-227H2,1-5H3,(H2,228,309)(H2,229,310)(H2,230,311)(H,249,272)(H,264,312)(H,265,314)(H,266,313)(H,267,323)(H,268,324)(H,269,325)(H,270,326)(H,271,349)(H,273,315)(H,274,317)(H,275,318)(H,276,316)(H,277,319)(H,278,339)(H,279,343)(H,280,328)(H,281,330)(H,282,329)(H,283,332)(H,284,331)(H,285,334)(H,286,333)(H,287,347)(H,288,340)(H,289,341)(H,290,344)(H,291,335)(H,292,322)(H,293,342)(H,294,336)(H,295,327)(H,296,348)(H,297,337)(H,298,350)(H,299,351)(H,300,338)(H,301,345)(H,302,346)(H,320,321)(H,353,354)(H4,231,232,250)(H4,233,234,251)(H4,235,236,252)(H4,237,238,253)(H4,239,240,254)(H4,241,242,255)(H4,243,244,256)(H4,245,246,257)(H4,247,248,258)
InChI Key
DSGGVPGAEGYDOM-UHFFFAOYSA-N

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Nucleic Acids SynthesiscGMP Peptide ServicePeptide Modification ServicesCustom Conjugation ServicePeptide Synthesis ServicesEpitope Mapping ServicesPeptide CDMOPeptide Analysis Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers