APTSTAT3-9R

APTSTAT3-9R combines a STAT3-targeting aptide sequence with a nona-arginine translocation motif. High cationic density promotes efficient uptake, while the targeting segment binds structured STAT3 domains. Researchers evaluate its conformational stability and inhibitory potential. Applications include signaling-pathway analysis, peptide-based inhibition, and nuclear-localization studies.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R2775

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C223H330N80O51
M.W/Mr.
4947.51
Sequence
One Letter Code:HGFQWPGSWTWENGKWTWKGAYQFLKGGGGSRRRRRRRRR
Three Letter Code:{Fluorescein-5-carbonyl}-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH

APTSTAT3-9R is a synthetic peptide designed as a cell-permeable inhibitor targeting the Signal Transducer and Activator of Transcription 3 (STAT3) signaling pathway. This peptide comprises a STAT3-specific aptamer sequence conjugated to a nona-arginine (9R) cell-penetrating motif, enabling efficient intracellular delivery. STAT3 is a key transcription factor implicated in various cellular processes, including proliferation, differentiation, and survival, and its dysregulation is frequently associated with oncogenesis and inflammatory responses. The functional design of APTSTAT3-9R allows researchers to selectively modulate STAT3 activity in vitro, making it a valuable tool for probing the molecular mechanisms underpinning STAT3-dependent signaling networks.

Signal transduction research: The peptide is widely used in studies investigating the STAT3 pathway, a central node in numerous cytokine and growth factor signaling cascades. By competitively inhibiting STAT3 activation and nuclear translocation, APTSTAT3-9R enables precise dissection of STAT3-mediated transcriptional regulation. Researchers utilize it to delineate the specific contributions of STAT3 to gene expression profiles, cell cycle progression, and apoptosis in various cellular models. Its application provides critical insights into the molecular underpinnings of STAT3-driven biological phenomena and disease states.

Functional genomics: In functional genomics experiments, the peptide serves as a molecular tool to transiently suppress STAT3 activity without the need for permanent genetic manipulation. This feature is particularly advantageous for elucidating the immediate consequences of STAT3 inhibition on cellular transcriptomes and proteomes. By using APTSTAT3-9R, investigators can perform time-resolved studies to identify primary STAT3 target genes and downstream effectors, thereby advancing the understanding of gene regulatory networks controlled by this transcription factor.

Cell-based assay development: The cell-penetrating properties conferred by the nona-arginine tag make this peptide suitable for use in a variety of cell-based assays. Its robust intracellular delivery facilitates the assessment of STAT3 function in primary cells, immortalized cell lines, and organoid cultures. Researchers employ it to validate STAT3-dependent phenotypes, screen for pathway modulators, and optimize experimental conditions for high-content imaging or flow cytometry. The versatility of APTSTAT3-9R in these applications supports the development of robust in vitro models for pathway interrogation.

Drug discovery and target validation: The peptide is instrumental in early-stage drug discovery programs focused on STAT3 as a therapeutic target. By selectively inhibiting STAT3, it serves as a benchmark tool for evaluating the efficacy of novel small-molecule inhibitors or biological agents. Its use in target validation studies helps distinguish on-target from off-target effects, refine structure-activity relationships, and prioritize lead compounds based on functional outcomes. This approach accelerates the translation of STAT3-targeted strategies from basic research to preclinical development.

Mechanistic studies of disease models: APTSTAT3-9R is frequently applied in mechanistic research using disease-relevant in vitro models, such as those for cancer, inflammation, and immune dysregulation. By modulating STAT3 activity, researchers can interrogate its role in pathological processes, including aberrant cell proliferation, resistance to apoptosis, and altered immune signaling. These studies provide foundational knowledge for identifying biomarkers, understanding disease etiology, and exploring combinatorial intervention strategies involving STAT3 pathway modulation.

InChI
InChI=1S/C223H330N80O51/c1-116(2)88-156(200(339)278-141(52-22-25-75-224)185(324)268-107-174(314)265-105-172(312)264-106-173(313)266-108-176(316)276-166(113-304)208(347)287-150(61-34-84-256-221(243)244)195(334)285-148(59-32-82-254-219(239)240)193(332)283-146(57-30-80-252-217(235)236)191(330)281-144(55-28-78-250-215(231)232)189(328)280-145(56-29-79-251-216(233)234)190(329)282-147(58-31-81-253-218(237)238)192(331)284-149(60-33-83-255-220(241)242)194(333)286-151(62-35-85-257-222(245)246)196(335)291-155(214(353)354)63-36-86-258-223(247)248)293-203(342)159(90-121-40-10-7-11-41-121)294-197(336)152(69-72-169(228)309)289-202(341)158(91-122-65-67-129(308)68-66-122)292-183(322)117(3)273-175(315)109-269-186(325)142(53-23-26-76-225)279-204(343)160(92-123-99-259-136-47-17-12-42-130(123)136)298-211(350)181(118(4)306)301-206(345)162(94-125-101-261-138-49-19-14-44-132(125)138)295-188(327)143(54-24-27-77-226)274-177(317)111-270-187(326)164(98-171(230)311)297-198(337)154(71-74-180(320)321)290-205(344)161(93-124-100-260-137-48-18-13-43-131(124)137)299-212(351)182(119(5)307)302-207(346)163(95-126-102-262-139-50-20-15-45-133(126)139)296-209(348)167(114-305)277-179(319)112-271-210(349)168-64-37-87-303(168)213(352)165(96-127-103-263-140-51-21-16-46-134(127)140)300-199(338)153(70-73-170(229)310)288-201(340)157(89-120-38-8-6-9-39-120)275-178(318)110-267-184(323)135(227)97-128-104-249-115-272-128/h6-21,38-51,65-68,99-104,115-119,135,141-168,181-182,259-263,304-308H,22-37,52-64,69-98,105-114,224-227H2,1-5H3,(H2,228,309)(H2,229,310)(H2,230,311)(H,249,272)(H,264,312)(H,265,314)(H,266,313)(H,267,323)(H,268,324)(H,269,325)(H,270,326)(H,271,349)(H,273,315)(H,274,317)(H,275,318)(H,276,316)(H,277,319)(H,278,339)(H,279,343)(H,280,328)(H,281,330)(H,282,329)(H,283,332)(H,284,331)(H,285,334)(H,286,333)(H,287,347)(H,288,340)(H,289,341)(H,290,344)(H,291,335)(H,292,322)(H,293,342)(H,294,336)(H,295,327)(H,296,348)(H,297,337)(H,298,350)(H,299,351)(H,300,338)(H,301,345)(H,302,346)(H,320,321)(H,353,354)(H4,231,232,250)(H4,233,234,251)(H4,235,236,252)(H4,237,238,253)(H4,239,240,254)(H4,241,242,255)(H4,243,244,256)(H4,245,246,257)(H4,247,248,258)
InChI Key
DSGGVPGAEGYDOM-UHFFFAOYSA-N

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
cGMP Peptide ServiceCustom Conjugation ServicePeptide Modification ServicesPeptide Synthesis ServicesPeptide CDMOEpitope Mapping ServicesPeptide Nucleic Acids SynthesisPeptide Analysis Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers