Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | SRWPSPGRPRPFPGRPKPIFRPRPCNCYAPPCPCDRW |
Activity | Antibacterial |
Host Chemicals | Hyas araneus |
Length | 37 |
SwissProt ID | A6XMY0 |
1. Immune responses to homocitrulline-and citrulline-containing peptides in rheumatoid arthritis
3. An Open-label, Single-center, Safety and Efficacy Study of Eyelash Polygrowth Factor Serum
4. Emerging applications of nanotechnology for diagnosis and therapy of disease: a review
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.