Keywords Search Google Search Search

Arasin 2

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2679
Sequence	SRWPSPGRPRPFPGRPNPIFRPRPCICVRQPCPCDTY
Activity	Antimicrobial

CAT#	Product Name	Inquiry
AF155	Curvalicin-28a	Inquiry
AF2249	Brevinin-2SN1	Inquiry
AF2554	Glycine-rich protein GWK	Inquiry
AF2098	Ranatuerin-2BYa	Inquiry
AF500	Temporin-RN3	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

The application of nafarelin acetate in hormonal therapy

Nafarelin acetate is a gonadotropin-releasing hormone (GnRH) agonist which is as effective as danazol in the tre ...

Atosiban Gives Preterm Labor A Maintenance Treatment

This article will give a brief introduction about atosiban and focus on its role played in the treatment of pret ...

Function of carnosine in skin, food and body

Carnosine (β-alanyl-l-histidine), containing an imidazole moiety, is an intramuscular dipeptide consisting of β ...

Function of icatibant in hereditary angioedema

Icatibant, sold under the trade name Firazyr, is a plasma kallikrein inhibitor and the bradykinin B2 receptor an ...

Function of caprooyl tetrapeptide-3 in skin

Caprooyl tetrapeptide-3, an anti-wrinkle peptide, a reaction product of caproic acid and tetrapeptide-3, compris ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Hyas araneus
Length	37
SwissProt ID	ABI74602