Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C195H300N56O56S1 |
M.W/Mr. | 4357.0 |
Sequence | DAEFRHDSGYEVHHQKLVFFARDVGSNKGAIIGLMVGGVV |
Length | 40 |
2. Implications of ligand-receptor binding kinetics on GLP-1R signalling
3. Urinary Metabolites Associated with Blood Pressure on a Low-or High-Sodium Die
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.