Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | VLLFLFQAAPGSADAPFADTAACRSQGNFCRAGACPPTFAASGSCHGGLLNCCAK |
Activity | Gram+ & Gram-, |
Host Chemicals | liver, Peking duck, Anas platyrhynchos |
Length | 55 |
1. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
2. The spatiotemporal control of signalling and trafficking of the GLP-1R
3. C-Peptide replacement therapy and sensory nerve function in type 1 diabetic neuropathy
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.