Keywords Search Google Search Search

Bactericidin B-3

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2687
Sequence	WNPFKELERAGQRVRDAIISAGPAVATVGQAAAIARG
Activity	Antibacterial

CAT#	Product Name	Inquiry
AF2592	Esculentin-2HSa	Inquiry
AF1175	Brevinin-1-RAA6 peptide precursor	Inquiry
AF810	Bombinin H1	Inquiry
AF1160	Ranatuerin-2PRc precursor	Inquiry
AF2511	Ostricacin-1	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

The therapeutic function of DAPTA

DAPTA (D-[Ala]-Ser-Thr-Thr-Thr-Asn-Tyr-Thr-amide), D-Ala-Peptide T amide, is one of analogue of peptide T, which ...

Brief information and effect of bradykinin

Overview of the kinin system Kinins are peptide hormones that are formed as part of the kinin-kallikrein system (KKS). kinin ...

GR 64349, A Selective and Potent NK2 Agonist

GR 64349 is a selective and potent NK2 agonist (EC50 = 3.7 nM in rat colon) with activity comparable to that of ...

Huwentoxin IV, A Kind of Selective NaV1.7 Channel Blocker

Huwentoxin IV, a 35-amino-acid-residue polypeptide from Chinese tarantula Ornithoctonus huwena venom, is a kind ...

Function of teriparatide in the treatment of osteoporosis

Teriparatide is a human parathyroid hormone analog with the same structure as the N-terminal 34 amino acid seque ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Manduca sexta
Length	37
SwissProt ID	P14663