Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | TSYGNGVHCNKSKCWIDVSELETYKAGTVSNPKDILW |
Activity | Antibacterial |
Host Chemicals | Lactococcus lactis subsp. lactis |
Length | 37 |
SwissProt ID | P83002 |
2. Myotropic activity of allatostatins in tenebrionid beetles
5. Implications of ligand-receptor binding kinetics on GLP-1R signalling
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.