CAT# | AF2683 |
Sequence | TSYGNGVHCNKSKCWIDVSELETYKAGTVSNPKDILW |
Activity | Antibacterial |
Host Chemicals | Lactococcus lactis subsp. lactis | Length | 37 | SwissProt ID | P83002 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF2145 | Oral Mucosal Alpha-Defensin | Inquiry | ||
AF1460 | Dermaseptin-5 | Inquiry | ||
AF2033 | Viphi A | Inquiry | ||
AF418 | Snakin-2 | Inquiry | ||
AF1436 | Caerin-1.19 | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
of skin aging Skin aging is the obvious external manifestation of a natural process occurring in tissues and or ...
Proteolytic Processing of APP Following discovery of the full-length APP cDNA clone, numerous studies were undertaken to dete ...
Iron chelating agent is a new type of iron-removing treatment based on the combination of directional and in viv ...
Myristoyl hexapeptide-4, a stabilized peptide, is a synthetic peptide containing lysine, threonine and serine re ...
Peptides are the ideal drug molecules because of their high affinity, high selectivity, low toxicity, and easy synthesis. Sci ...