Potent and selective KV11.1 (hERG) channel blocker. Selective for KV11.1 over a panel of 14 other potassium channels. Dose-dependently prolongs QTc interval in isolated rabbit heart.
CAT# | R1045 |
CAS | 524962-01-4 |
M.F/Formula | C174H261N51O52S6 |
M.W/Mr. | 4091.65 |
Sequence | RPTDIKCSESYQCFPVCKSRFGKTNGRCVNGFCDCF(Disulfide bridge: Cys7 and Cys28,Cys13 and Cys33,Cys17 and Cys35) |
Labeling Target | KV11.1 (hERG) channel |
Activity | Blocker |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Myristoyl pentapeptide-11 is classified to cosmetic peptide and single peptide, a common saturated fatty acid, w ...
The factors of skin aging The skin is one of the largest organs of the body. In many cases, as the person's age changes, the ...
Teriparatide is a human parathyroid hormone analog with the same structure as the N-terminal 34 amino acid seque ...
The cyclopentapeptide FC 131 (cyclo(-L-Arg1-L-Arg2-L-2-Nal3-Gly4-D-Tyr5-), 2-Nal=3-(2-naphthyl) alanine)) is an ...
Palmitoyl Tripeptide-1 is also called Part of Matrixyl 3000. Palmitoyl Oligopeptide and Pal-GHK are believed to be able to st ...