Beta-Amyloid (4-42)

Beta-Amyloid (4-42) spans nearly the full-length peptide, omitting only the first few residues. The fragment displays rapid β-sheet formation and robust aggregation behavior. Its extended C-terminal hydrophobic region enhances fibril stability. Research applications include aggregation kinetics, supramolecular modeling, and structure-assembly relationship studies.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: A13248

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.W/Mr.
4198.8
Sequence
FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Length
39

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Epitope Mapping ServicesPeptide CDMOCustom Conjugation ServicePeptide Modification ServicesPeptide Synthesis ServicescGMP Peptide ServicePeptide Analysis ServicesPeptide Nucleic Acids Synthesis
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers

Creative Peptides customer logo 1 Creative Peptides customer logo 2 Creative Peptides customer logo 3 Creative Peptides customer logo 4 Creative Peptides customer logo 5 Creative Peptides customer logo 6 Creative Peptides customer logo 7 Creative Peptides customer logo 8 Creative Peptides customer logo 9 Creative Peptides customer logo 10 Creative Peptides customer logo 11 Creative Peptides customer logo 12 Creative Peptides customer logo 13 Creative Peptides customer logo 14 Creative Peptides customer logo 15 Creative Peptides customer logo 16 Creative Peptides customer logo 17 Creative Peptides customer logo 18 Creative Peptides customer logo 19 Creative Peptides customer logo 20 Creative Peptides customer logo 21 Creative Peptides customer logo 22 Creative Peptides customer logo 23 Creative Peptides customer logo 24 Creative Peptides client partner 1 Creative Peptides client partner 2 Creative Peptides client partner 3 Creative Peptides client partner 4 Creative Peptides client partner 5 Creative Peptides client partner 6 Creative Peptides client partner 7 Creative Peptides client partner 8 Creative Peptides client partner 9 Creative Peptides client partner 10 Creative Peptides client partner 11 Creative Peptides client partner 12 Creative Peptides client partner 13 Creative Peptides client partner 14 Creative Peptides client partner 15 Creative Peptides client partner 16 Creative Peptides client partner 17 Creative Peptides client partner 18 Creative Peptides client partner 19 Creative Peptides client partner 20 Creative Peptides client partner 21 Creative Peptides client partner 22 Creative Peptides client partner 23 Creative Peptides client partner 24