Registration of APIs CMC information required for an IND
IND and NDA support Drug master files (DMF) filing
M.W/Mr. | 4233.8 |
Sequence | DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV |
Length | 40 |
1. Low bone turnover and low BMD in Down syndrome: effect of intermittent PTH treatment
2. Immune-awakening Saccharomyces-inspired nanocarrier for oral target delivery to lymph and tumors
5. Emu oil in combination with other active ingredients for treating skin imperfections
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us. We will endeavor to provide highly satisfying products and services.