Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | NEPVSCIRNGGICQYRCIGLRHKIGTCGSPFKCCK |
Activity | Antibacterial |
Host Chemicals | Mus musculus |
Length | 35 |
SwissProt ID | Q91V82 |
3. Myotropic activity of allatostatins in tenebrionid beetles
4. TMEM16F and dynamins control expansive plasma membrane reservoirs
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.