Keywords Search Google Search Search

Beta-defensin 38

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2943
Sequence	IGPDTKKCVQRKNACHYFECPWLYYSVGTCYKGKGKCCQKRY
Activity	Antibacterial

CAT#	Product Name	Inquiry
AF2280	Neutrophil defensin 6	Inquiry
AF788	Alpha-basrubrin	Inquiry
AF223	Temporin-1Oc	Inquiry
AF1304	Brevinin-1PLc	Inquiry
AF1018	Brevinin-2SN4 antimicrobial peptide precursor	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

The Usage of Pentapeptide-31

of skin aging Skin aging is an obvious external manifestation of the natural process occurring in tissues and or ...

Function of Timonacic in Cancer

Timonacic's chemical name, L-Syrosin-4, is a new anti-tumor drug that converts cancer cells into normal cells. E ...

Palmitoyl Hexapeptide-12, a natural powerful antiager

Introduce of lipopeptide Lipopeptide (peptidolipid), also known as acylpeptide, is composed of hydrophilic peptide bond and l ...

Function of NFAT inhibitor

NFAT, the nuclear factor of activated T cells, is a family of transcription factors that play an important role ...

The Amyloid Precursor Protein and Alzheimer's Disease

The β-amyloid precursor protein (APP) is connected to Alzheimer's disease by both biochemistry and genetics. As ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Mus musculus
Length	42
SwissProt ID	Q7TNV7