1. Home
  2. Products
  3. Therapeutic Peptides
  4. Peptide Inhibitors
  5. Big Endothelin-1 (1-31) (human, bovine) Big ET-1 (1-31) (human, bovine)

Big Endothelin-1 (1-31) (human, bovine) Big ET-1 (1-31) (human, bovine)

H-Cys(1)-Ser-Cys(2)-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys(2)-Val-Tyr-Phe-Cys(1)-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-His-Val-Val-Pro-Tyr-OH features multiple cysteine residues forming potential disulfide networks that stabilize complex tertiary structures. The diverse residue distribution shapes hydrophobic, polar, and charged regions within the peptide. Researchers analyze its conformational behavior and binding interactions across varied environments. Applications include structural biology, sequence engineering, and motif-based functional studies.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.
Big Endothelin-1 (1-31) (human, bovine) Big ET-1 (1-31) (human, bovine)(CAS 133972-52-8)

CAT No: R2427

CAS No:133972-52-8

Synonyms/Alias:H-Cys(1)-Ser-Cys(2)-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys(2)-Val-Tyr-Phe-Cys(1)-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-His-Val-Val-Pro-Tyr-OH;133972-52-8;

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C162H236N38O47S5
M.W/Mr.
3628.2
Sequence
One Letter Code:CSCSSLMDKECVYFCHLDIIWVNTPEHVVPY
Three Letter Code:H-Cys(1)-Ser-Cys(2)-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys(2)-Val-Tyr-Phe-Cys(1)-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-His-Val-Val-Pro-Tyr-OH
InChI
InChI=1S/C162H236N38O47S5/c1-19-83(15)129(158(242)183-105(59-89-65-168-96-33-25-24-32-94(89)96)143(227)192-125(79(7)8)156(240)184-108(62-120(165)207)145(229)198-131(85(17)204)161(245)200-52-29-35-118(200)153(237)174-99(46-48-122(210)211)134(218)178-107(61-91-67-167-76-170-91)144(228)193-127(81(11)12)157(241)195-128(82(13)14)160(244)199-51-28-36-119(199)154(238)185-111(162(246)247)58-88-39-43-93(206)44-40-88)197-159(243)130(84(16)20-2)196-146(230)110(64-124(214)215)181-138(222)102(55-78(5)6)175-141(225)106(60-90-66-166-75-169-90)179-150(234)115-72-250-249-71-95(164)132(216)186-112(68-201)149(233)191-116-73-251-252-74-117(152(236)194-126(80(9)10)155(239)182-104(57-87-37-41-92(205)42-38-87)139(223)177-103(140(224)190-115)56-86-30-22-21-23-31-86)189-135(219)98(45-47-121(208)209)172-133(217)97(34-26-27-50-163)171-142(226)109(63-123(212)213)180-136(220)100(49-53-248-18)173-137(221)101(54-77(3)4)176-147(231)113(69-202)187-148(232)114(70-203)188-151(116)235/h21-25,30-33,37-44,65-67,75-85,95,97-119,125-131,168,201-206H,19-20,26-29,34-36,45-64,68-74,163-164H2,1-18H3,(H2,165,207)(H,166,169)(H,167,170)(H,171,226)(H,172,217)(H,173,221)(H,174,237)(H,175,225)(H,176,231)(H,177,223)(H,178,218)(H,179,234)(H,180,220)(H,181,222)(H,182,239)(H,183,242)(H,184,240)(H,185,238)(H,186,216)(H,187,232)(H,188,235)(H,189,219)(H,190,224)(H,191,233)(H,192,227)(H,193,228)(H,194,236)(H,195,241)(H,196,230)(H,197,243)(H,198,229)(H,208,209)(H,210,211)(H,212,213)(H,214,215)(H,246,247)/t83-,84-,85+,95-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,109-,110-,111-,112-,113-,114-,115-,116-,117-,118-,119-,125-,126-,127-,128-,129-,130-,131-/m0/s1
InChI Key
JKSRICZEYPPRFI-QPAZCVSESA-N

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Modification ServicesEpitope Mapping ServicesPeptide Nucleic Acids SynthesisCustom Conjugation ServicecGMP Peptide ServicePeptide CDMOPeptide Analysis ServicesPeptide Synthesis Services
Hot Products
Elcatonin Acetate

Elcatonin Acetate is a calcitonin analog supporting bone metabolism research. Buy Elcatonin peptide online to study calcium regulation and osteoporosis.

Read More Read More
Gonadorelin Acetate

Gonadorelin Acetate stimulates LH and FSH release in fertility research. Purchase Gonadorelin peptide powder from a verified peptide supplier for reproductive studies.

Read More Read More
Carbetocin

Carbetocin is a synthetic oxytocin analog that promotes uterine contraction and postpartum recovery. Buy Carbetocin peptide powder from a professional supplier for reproductive research.

Read More Read More
Buserelin Acetate

Buserelin Acetate is a GnRH agonist peptide regulating reproductive hormones. Buy Buserelin peptide powder online to explore fertility and hormone-dependent tumor research.

Read More Read More
GLP-1 (7-37) Acetate

GLP-1 (7-37) Acetate is a synthetic peptide for appetite and insulin regulation. Order GLP-1 peptide powder from a trusted supplier for metabolic research.

Read More Read More
Teriparatide Acetate

Teriparatide Acetate is a bone-forming peptide supporting osteoporosis research. Buy Teriparatide peptide online to study bone growth and calcium metabolism.

Read More Read More
Argipressin

Argipressin peptide regulates water balance and blood pressure in biological systems. Shop pure Argipressin peptide online for cardiovascular and kidney research.

Read More Read More
Terlipressin Acetate

Terlipressin Acetate is a synthetic vasopressin analog peptide used for vascular and liver research. Buy Terlipressin peptide powder online from a trusted peptide supplier for professional studies.

Read More Read More
Angiotensin II

Angiotensin II peptide regulates blood pressure and vascular constriction. Purchase this synthetic research peptide to support cardiovascular and renal function studies.

Read More Read More
Fertirelin Acetate

Fertirelin Acetate is a synthetic peptide that promotes ovulation and fertility. Purchase Fertirelin research peptide for breeding and hormonal studies.

Read More Read More
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers