CAT# | B1804 |
CAS | 117345-87-6 |
M.F/Formula | C₁₄₉H₂₅₀N₅₂O₄₄S₃ |
M.W/Mr. | 3570.15 |
Sequence | One Letter Code: SPKTMRDSGCFGRRLDRIGSLSGLGCNVLRRY three Letter Code: H-Ser-Pro-Lys-Thr-Met-Arg-Asp-Ser-Gly-Cys-Phe-Gly-Arg-Arg-Leu-Asp-Arg-Ile-Gly-Ser-Leu-Ser-Gly-Leu-Gly-Cys-Asn-Val-Leu-Arg-Arg-Tyr-OH trifluoroacetate salt (Disulfide bond) |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
10Panx is a panx 1 mimetic inhibitor that easily and reversibly inhibits panx1 currents. In cells that are diffi ...
AdTx1, also called as ρ-Da1a, is a polypeptide of 65 amino acids stabilized by four disulfide bonds, which has a ...
Protirelin is also known as thyrotropin releasing hormone (TRH), a peptide hormone secreted by the hypothalamus. ...
Nociceptin/orphanin FQ (N/OFQ) modulates various biological functions, including nociception, via selective stim ...
Sincalide is a brain and intestinal skin with a variety of physiological effects. It is widely distributed in th ...