BNP (1-32), porcine

BNP (1-32), porcine is a natriuretic peptide containing a conserved disulfide-linked ring essential for structural integrity. The sequence supports studies of hemodynamic peptide families across species. Its physicochemical profile aids in assessing folding pathways and receptor-selective interactions. Research applications include comparative structural analysis, ligand-binding profiling, and peptide engineering.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: B1804

CAS No:117345-87-6

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C₁₄₉H₂₅₀N₅₂O₄₄S₃
M.W/Mr.
3570.15
Sequence
One Letter Code: SPKTMRDSGCFGRRLDRIGSLSGLGCNVLRRY
three Letter Code: H-Ser-Pro-Lys-Thr-Met-Arg-Asp-Ser-Gly-Cys-Phe-Gly-Arg-Arg-Leu-Asp-Arg-Ile-Gly-Ser-Leu-Ser-Gly-Leu-Gly-Cys-Asn-Val-Leu-Arg-Arg-Tyr-OH trifluoroacetate salt (Disulfide bond)
Source#
Synthetic

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Epitope Mapping ServicesPeptide Modification ServicesPeptide CDMOCustom Conjugation ServicePeptide Synthesis ServicesPeptide Analysis ServicescGMP Peptide ServicePeptide Nucleic Acids Synthesis
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers