Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C₁₄₉H₂₅₀N₅₂O₄₄S₃ |
M.W/Mr. | 3570.15 |
Sequence | One Letter Code: SPKTMRDSGCFGRRLDRIGSLSGLGCNVLRRY three Letter Code: H-Ser-Pro-Lys-Thr-Met-Arg-Asp-Ser-Gly-Cys-Phe-Gly-Arg-Arg-Leu-Asp-Arg-Ile-Gly-Ser-Leu-Ser-Gly-Leu-Gly-Cys-Asn-Val-Leu-Arg-Arg-Tyr-OH trifluoroacetate salt (Disulfide bond) |
Source# | Synthetic |
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.