C-Type Natriuretic Peptide (1-53), human

C-Type Natriuretic Peptide (1-53), human is the 1-53 fragment of C-Type Natriuretic Peptide. C-Type Natriuretic Peptide is natriuretic peptide family peptide that is involved in the maintenance of electrolyte-fluid balance and vascular tone.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R1312

CAS No:141294-77-1

Synonyms/Alias:CNP-53 (human)

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C₂₅₁H₄₁₇N₈₁O₇₁S₃
M.W/Mr.
5801.77
Sequence
One Letter Code: DLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC
three Letter Code: Asp-Leu-Arg-Val-Asp-Thr-Lys-Ser-Arg-Ala-Ala-Trp-Ala-Arg-Leu-Leu-Gln-Glu-His-Pro-Asn-Ala-Arg-Lys-Tyr-Lys-Gly-Ala-Asn-Lys-Lys-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys

C-Type Natriuretic Peptide (1-53), human is a synthetic peptide corresponding to the full-length sequence of the endogenous C-type natriuretic peptide found in humans. As a member of the natriuretic peptide family, it plays a significant role in vascular biology, cellular signaling, and homeostatic regulation of blood pressure and fluid balance. Its unique biochemical properties, including its capacity to interact with natriuretic peptide receptors and modulate cyclic guanosine monophosphate (cGMP) pathways, make it a valuable tool for researchers investigating cardiovascular, renal, and skeletal systems. The structural fidelity of the (1-53) fragment ensures functional relevance in experimental models, supporting the exploration of physiological and pathophysiological mechanisms associated with natriuretic peptide signaling.

Receptor Pharmacology Studies: CNP (1-53) is widely utilized in receptor binding and activation assays to characterize the specificity and affinity of natriuretic peptide receptors, particularly NPR-B (NPR2). Its application enables the dissection of ligand-receptor interactions, downstream cGMP generation, and the mapping of receptor-mediated signaling cascades. These studies are crucial for elucidating the molecular mechanisms underlying natriuretic peptide function and for advancing the development of receptor-targeted modulators.

Vascular Biology Research: The peptide serves as a key reagent in vascular smooth muscle cell and endothelial cell studies, where it is used to investigate vasorelaxation, anti-proliferative effects, and endothelial function. By modulating cGMP-dependent pathways, CNP (1-53) facilitates the examination of mechanisms involved in vascular tone regulation, angiogenesis, and the maintenance of vascular homeostasis. Researchers leverage its activity to model vascular responses and to probe the role of natriuretic peptides in cardiovascular health and disease.

Cell Signaling Pathway Analysis: In cellular and molecular biology laboratories, this peptide is employed to activate natriuretic peptide signaling pathways, allowing the assessment of downstream effectors such as protein kinases, phosphodiesterases, and transcription factors. Its use supports the investigation of cGMP-mediated signaling networks and their impact on cell proliferation, differentiation, and apoptosis. These studies provide critical insights into the cross-talk between natriuretic peptide signaling and other cellular pathways.

Bone and Cartilage Research: CNP (1-53) is instrumental in studies focused on skeletal development and homeostasis. It is used to explore its regulatory role in chondrocyte proliferation, differentiation, and extracellular matrix synthesis, contributing to the understanding of endochondral ossification and bone growth. Experimental models employing this peptide help clarify the molecular basis of cartilage physiology and the potential modulation of skeletal disorders at the cellular level.

Peptide Functional Assays: The full-length sequence of CNP (1-53) makes it an ideal standard for functional bioassays, including those designed to quantify natriuretic peptide activity or to benchmark the efficacy of novel analogs and antagonists. Its well-characterized activity profile ensures reproducibility and reliability in comparative studies, facilitating the validation of assay systems and the development of new peptide-based research tools. Through these diverse applications, CNP (1-53) supports advanced research in physiology, pharmacology, and molecular biology related to natriuretic peptide signaling.

Source#
Synthetic

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
cGMP Peptide ServicePeptide Analysis ServicesPeptide Nucleic Acids SynthesisPeptide Synthesis ServicesCustom Conjugation ServicePeptide Modification ServicesEpitope Mapping ServicesPeptide CDMO
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers